DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12054 and JAZF1

DIOPT Version :9

Sequence 1:NP_651853.1 Gene:CG12054 / 43694 FlyBaseID:FBgn0039831 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_778231.2 Gene:JAZF1 / 221895 HGNCID:28917 Length:243 Species:Homo sapiens


Alignment Length:241 Identity:121/241 - (50%)
Similarity:155/241 - (64%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVFLINVCKYNGCGITFPSLSDLISHIEDTHIDYDPKVVEQKEQAQPACLPLSYVLRFITEENRK 66
            |.|..|.|::.|||:.||:|:|||.||||.|||.||:|:|::|..||..:.|||:.||:|:..|:
Human     7 ASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARR 71

  Fly    67 EAGSFLASNTTAPPTTNSGSNAAGHGNGNVELKRKLAIKHHSYSM----------SSSNRSTTPT 121
            |..|.  .....|..:.:.|::...||.:.      ..:|.|.|:          |||.||:|||
Human    72 EQESL--KKKIQPKLSLTLSSSVSRGNVST------PPRHSSGSLTPPVTPPITPSSSFRSSTPT 128

  Fly   122 GSEMDEDEMVVTESEDSNDSWTTEE-FSSEFIMRYGSRHSGGGSNGTPGNEKPFACPVPGCKKRY 185
            |||.||:|:...|| ||::|||||. .|||.|:      |....||  |.|||||||||||||||
Human   129 GSEYDEEEVDYEES-DSDESWTTESAISSEAIL------SSMCMNG--GEEKPFACPVPGCKKRY 184

  Fly   186 KNVNGIKYHSKNGHKKDGRVRKGYKCHCGKSYKTAQGLKNHALHTH 231
            |||||||||:||||:...||||.:||.|||||||||||::|.::.|
Human   185 KNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12054NP_651853.1 SFP1 <123..231 CDD:227516 68/108 (63%)
JAZF1NP_778231.2 Required for interaction with NR2C2. /evidence=ECO:0000269|PubMed:15302918 39..79 17/41 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..151 27/68 (40%)
SFP1 <169..230 CDD:227516 46/60 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5189
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18291
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3951
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005653
OrthoInspector 1 1.000 - - oto90570
orthoMCL 1 0.900 - - OOG6_108585
Panther 1 1.100 - - LDO PTHR23057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1327
SonicParanoid 1 1.000 - - X5309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.680

Return to query results.
Submit another query.