DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12054 and jazf1

DIOPT Version :9

Sequence 1:NP_651853.1 Gene:CG12054 / 43694 FlyBaseID:FBgn0039831 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_002933429.1 Gene:jazf1 / 100496608 XenbaseID:XB-GENE-950886 Length:244 Species:Xenopus tropicalis


Alignment Length:247 Identity:119/247 - (48%)
Similarity:154/247 - (62%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVFLINVCKYNGCGITFPSLSDLISHIEDTHIDYDPKVVEQKEQAQPACLPLSYVLRFITEENRK 66
            |.|..|.|::.|||:.|.:|::||.||||.|||.||:|:|::|..||..:.|||:.||:|:..|:
 Frog     8 ASFFSNACRFGGCGLHFTTLAELIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARR 72

  Fly    67 E----------------AGSFLASNTTAPPTTNSGSNAAGHGNGNVELKRKLAIKHHSYSMSSSN 115
            |                :.|....|.:.||.         ||:|::.......|     :.|||.
 Frog    73 EQETLKKKIQPKLSLTLSSSVSRGNVSTPPR---------HGSGSLTPPVTPPI-----TPSSSF 123

  Fly   116 RSTTPTGSEMDEDEMVVTESEDSNDSWTTEE-FSSEFIMRYGSRHSGGGSNGTPGNEKPFACPVP 179
            ||:||||||.||:|:...|| ||::|||||. .|||.|:      |....||  |:|||||||||
 Frog   124 RSSTPTGSEYDEEEVDYEES-DSDESWTTESAISSEAIL------SSMCMNG--GDEKPFACPVP 179

  Fly   180 GCKKRYKNVNGIKYHSKNGHKKDGRVRKGYKCHCGKSYKTAQGLKNHALHTH 231
            |||||||||||||||:||||:...||||.:||.|||||||||||::|.::.|
 Frog   180 GCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12054NP_651853.1 SFP1 <123..231 CDD:227516 68/108 (63%)
jazf1XP_002933429.1 SFP1 <170..231 CDD:227516 46/60 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H18291
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005653
OrthoInspector 1 1.000 - - oto104371
Panther 1 1.100 - - LDO PTHR23057
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1327
SonicParanoid 1 1.000 - - X5309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.130

Return to query results.
Submit another query.