DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and atpH

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_051046.1 Gene:atpH / 844788 -ID:- Length:81 Species:Arabidopsis thaliana


Alignment Length:73 Identity:30/73 - (41%)
Similarity:41/73 - (56%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SAAKFIGAGAATVGVA--GSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLM 129
            |||..|.||.| ||:|  |.|.|.||..|..:.|.||.|..:.::....:|..|..||:.::.|:
plant     6 SAASVIAAGLA-VGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLV 69

  Fly   130 MAFLLLFA 137
            :|..||||
plant    70 VALALLFA 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 30/73 (41%)
atpHNP_051046.1 atpH 1..81 CDD:177001 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.