powered by:
Protein Alignment ATPsynC and atpH
DIOPT Version :9
Sequence 1: | NP_001247382.1 |
Gene: | ATPsynC / 43693 |
FlyBaseID: | FBgn0039830 |
Length: | 138 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_051046.1 |
Gene: | atpH / 844788 |
-ID: | - |
Length: | 81 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 30/73 - (41%) |
Similarity: | 41/73 - (56%) |
Gaps: | 3/73 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 SAAKFIGAGAATVGVA--GSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLM 129
|||..|.||.| ||:| |.|.|.||..|..:.|.||.|..:.::....:|..|..||:.::.|:
plant 6 SAASVIAAGLA-VGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLV 69
Fly 130 MAFLLLFA 137
:|..||||
plant 70 VALALLFA 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ATPsynC | NP_001247382.1 |
ATP9 |
62..138 |
CDD:164765 |
30/73 (41%) |
atpH | NP_051046.1 |
atpH |
1..81 |
CDD:177001 |
30/73 (41%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.