DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and AT2G07671

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_178769.2 Gene:AT2G07671 / 815343 AraportID:AT2G07671 Length:85 Species:Arabidopsis thaliana


Alignment Length:85 Identity:49/85 - (57%)
Similarity:59/85 - (69%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFA 118
            |.:.:.|   ::...||.|||||||:..||:..|||.||.|||...||||||.:|.|.|||||||
plant     4 REYNSQP---EMLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFA 65

  Fly   119 LSEAMGLFCLMMAFLLLFAF 138
            |:||:.||..|||||:||.|
plant    66 LTEAIALFAPMMAFLILFVF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 46/75 (61%)
AT2G07671NP_178769.2 ATP-synt_Fo_c_ATP5G3 <33..81 CDD:349422 32/47 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2722
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I2201
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564365at2759
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - otm2606
orthoMCL 1 0.900 - - OOG6_101507
Panther 1 1.100 - - O PTHR10031
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.