DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and ATP5MC2

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_016874949.1 Gene:ATP5MC2 / 517 HGNCID:842 Length:198 Species:Homo sapiens


Alignment Length:142 Identity:91/142 - (64%)
Similarity:108/142 - (76%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FVSTVSRIAPVARSAFLANSKQYLRPLSSAIISQSQTLAAQN------TTPVALLPQIRSFQTSP 60
            ||||.|.:.        :.|:...||||:.::.:.:.|..::      :.|:..|...||||||.
Human    64 FVSTPSLVK--------STSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSA 120

  Fly    61 VTRDIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGL 125
            ::||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human   121 ISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGL 185

  Fly   126 FCLMMAFLLLFA 137
            ||||:|||:|||
Human   186 FCLMVAFLILFA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 72/76 (95%)
ATP5MC2XP_016874949.1 ATP9 124..198 CDD:164765 71/74 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5640
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57052
Inparanoid 1 1.050 165 1.000 Inparanoid score I4186
Isobase 1 0.950 - 0 Normalized mean entropy S423
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564365at2759
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - otm41075
orthoMCL 1 0.900 - - OOG6_101507
Panther 1 1.100 - - LDO PTHR10031
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R116
SonicParanoid 1 1.000 - - X620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.