DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and atp5mc1

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001005112.1 Gene:atp5mc1 / 448692 XenbaseID:XB-GENE-5907814 Length:130 Species:Xenopus tropicalis


Alignment Length:112 Identity:82/112 - (73%)
Similarity:91/112 - (81%) Gaps:5/112 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPLSSAIISQSQTLAAQNTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGAGIGT 90
            ||:|..::|.: .|..:...||    ..|..|:|...||||:|||||||||||||||||||||||
 Frog    23 RPVSVPLLSYT-GLRTEQLMPV----PARGIQSSVTCRDIDTAAKFIGAGAATVGVAGSGAGIGT 82

  Fly    91 VFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFA 137
            |||||||||||||||||||||||||||||||||||||||:|||:|||
 Frog    83 VFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 72/76 (95%)
atp5mc1NP_001005112.1 ATP9 56..130 CDD:164765 71/74 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4093
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564365at2759
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - otm48282
Panther 1 1.100 - - LDO PTHR10031
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R116
SonicParanoid 1 1.000 - - X620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.