DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and atp5mc1

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_998193.1 Gene:atp5mc1 / 406301 ZFINID:ZDB-GENE-040426-1966 Length:138 Species:Danio rerio


Alignment Length:139 Identity:91/139 - (65%)
Similarity:103/139 - (74%) Gaps:11/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FVSTVSRIAPVARSAFLANSKQYLRPLS---SAIISQSQTLAAQNTTPVALLPQIRSFQTSPVTR 63
            |||:.:.|.        ..|:...||:|   |...::|:..|....:..|||...|.||||..:|
Zfish     7 FVSSPAVIR--------GGSRALARPISVVFSRPEARSEQAALLPVSEAALLNLTRGFQTSVASR 63

  Fly    64 DIDSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCL 128
            |||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish    64 DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCL 128

  Fly   129 MMAFLLLFA 137
            |:|||:|||
Zfish   129 MVAFLILFA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 72/76 (95%)
atp5mc1NP_998193.1 ATP9 64..138 CDD:164765 71/74 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594338
Domainoid 1 1.000 122 1.000 Domainoid score I5590
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4123
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564365at2759
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - otm24862
orthoMCL 1 0.900 - - OOG6_101507
Panther 1 1.100 - - LDO PTHR10031
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R116
SonicParanoid 1 1.000 - - X620
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.