powered by:
Protein Alignment ATPsynC and atp6v0cb
DIOPT Version :9
Sequence 1: | NP_001247382.1 |
Gene: | ATPsynC / 43693 |
FlyBaseID: | FBgn0039830 |
Length: | 138 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991117.1 |
Gene: | atp6v0cb / 325402 |
ZFINID: | ZDB-GENE-030131-4127 |
Length: | 153 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 38/65 - (58%) |
Gaps: | 7/65 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLL 134
:||| .:||::|..|| ||.|..:.:.|.|:.| :||...||....:|.:||:.|::|.:|
Zfish 91 LGAG-LSVGLSGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVALIL 150
Fly 135 134
Zfish 151 150
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0636 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.