powered by:
Protein Alignment ATPsynC and atp9
DIOPT Version :9
Sequence 1: | NP_001247382.1 |
Gene: | ATPsynC / 43693 |
FlyBaseID: | FBgn0039830 |
Length: | 138 |
Species: | Drosophila melanogaster |
Sequence 2: | YP_009144710.1 |
Gene: | atp9 / 24573116 |
-ID: | - |
Length: | 76 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 45/69 - (65%) |
Similarity: | 56/69 - (81%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAF 132
|||:||||.:|:|:.|:|.||..||.:||.|.:||||:|..:|..||||||||||.||||||::|
Yeast 6 AAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSF 70
Fly 133 LLLF 136
||||
Yeast 71 LLLF 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
83 |
1.000 |
Domainoid score |
I1941 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
93 |
1.000 |
Inparanoid score |
I1522 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001031 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto99448 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101507 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10031 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R116 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X620 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.990 |
|
Return to query results.
Submit another query.