DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and atp9

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:YP_009144710.1 Gene:atp9 / 24573116 -ID:- Length:76 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:45/69 - (65%)
Similarity:56/69 - (81%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAF 132
            |||:||||.:|:|:.|:|.||..||.:||.|.:||||:|..:|..||||||||||.||||||::|
Yeast     6 AAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSF 70

  Fly   133 LLLF 136
            ||||
Yeast    71 LLLF 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 45/69 (65%)
atp9YP_009144710.1 ATP-synt_Fo_c_ATP5G3 8..72 CDD:349422 39/63 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I1941
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1522
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - oto99448
orthoMCL 1 0.900 - - OOG6_101507
Panther 1 1.100 - - LDO PTHR10031
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R116
SonicParanoid 1 1.000 - - X620
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.