DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and Atp6v0c

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_570836.1 Gene:Atp6v0c / 170667 RGDID:621394 Length:155 Species:Rattus norvegicus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:66/155 - (42%) Gaps:40/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AFLANSKQY-----LRPLSSAIISQSQTLA---AQNTTPVALL----PQIRSFQTSPV------- 61
            |.:.|:.:|     :...|||::..:...|   |::.|.:|.:    |::......||       
  Rat     2 ADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIA 66

  Fly    62 --------------TRDIDSAAKFIGAGAA-TVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQL 109
                          |..|.....|:..||. :||::|..||  ||.|..:.:.|.|:.|    :|
  Rat    67 IYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQP----RL 127

  Fly   110 FSYAILGFALSEAMGLFCLMMAFLL 134
            |...||....:|.:||:.|::|.:|
  Rat   128 FVGMILILIFAEVLGLYGLIVALIL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 26/76 (34%)
Atp6v0cNP_570836.1 V_ATP_synt_C 13..118 CDD:130170 23/104 (22%)
ATP-synt_Vo_c_ATP6C_rpt2 86..153 CDD:349416 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.