DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and ScpofMp09

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_039507.1 Gene:ScpofMp09 / 1669532 -ID:- Length:74 Species:Schizosaccharomyces pombe


Alignment Length:70 Identity:46/70 - (65%)
Similarity:60/70 - (85%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAF 132
            |||:||||.||:||:|:|.|||.:|.:||.|.:||||::..|||.|||||||:||.||||||:||
pombe     4 AAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATGLFCLMLAF 68

  Fly   133 LLLFA 137
            |:::|
pombe    69 LIIYA 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 46/70 (66%)
ScpofMp09NP_039507.1 ATP-synt_Fo_c_ATP5G3 6..70 CDD:349422 42/63 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2071
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1670
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - oto101049
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10031
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R116
SonicParanoid 1 1.000 - - X620
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.