DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and Atp5g1

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001154891.1 Gene:Atp5g1 / 11951 MGIID:107653 Length:136 Species:Mus musculus


Alignment Length:116 Identity:83/116 - (71%)
Similarity:102/116 - (87%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LRPLSSAIISQSQTLAAQ---NTTPVALLPQIRSFQTSPVTRDIDSAAKFIGAGAATVGVAGSGA 86
            :||:|::::|:.:..:.|   :::|:.:..  |.||||.::||||:|||||||||||||||||||
Mouse    22 IRPVSASLLSRPEAPSKQPSCSSSPLQVAR--REFQTSVISRDIDTAAKFIGAGAATVGVAGSGA 84

  Fly    87 GIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFA 137
            |||||||||||||||||||||||||||||||||||||||||||:|||:|||
Mouse    85 GIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 72/76 (95%)
Atp5g1NP_001154891.1 ATP9 62..136 CDD:164765 71/74 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5627
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4181
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564365at2759
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - otm43146
orthoMCL 1 0.900 - - OOG6_101507
Panther 1 1.100 - - LDO PTHR10031
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R116
SonicParanoid 1 1.000 - - X620
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.