DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynC and Atp5mc3

DIOPT Version :9

Sequence 1:NP_001247382.1 Gene:ATPsynC / 43693 FlyBaseID:FBgn0039830 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001348329.1 Gene:Atp5mc3 / 114630 RGDID:620052 Length:141 Species:Rattus norvegicus


Alignment Length:137 Identity:91/137 - (66%)
Similarity:109/137 - (79%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 APVARSAFL--ANSKQYLRPLSSAIISQSQTLAAQNTT-------PVALLPQIRSFQTSPVTRDI 65
            |.:||:..|  |.|:...||:|::::|:.:|...:.:|       .|..|.: |.||||.::|||
  Rat     5 AKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIR-REFQTSVISRDI 68

  Fly    66 DSAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMM 130
            |:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:
  Rat    69 DTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMV 133

  Fly   131 AFLLLFA 137
            |||:|||
  Rat   134 AFLILFA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynCNP_001247382.1 ATP9 62..138 CDD:164765 72/76 (95%)
Atp5mc3NP_001348329.1 ATP9 67..141 CDD:164765 71/74 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5505
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564365at2759
OrthoFinder 1 1.000 - - FOG0001031
OrthoInspector 1 1.000 - - otm45215
orthoMCL 1 0.900 - - OOG6_101507
Panther 1 1.100 - - LDO PTHR10031
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X620
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.