DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1542 and ebna1bp2

DIOPT Version :9

Sequence 1:NP_651850.1 Gene:CG1542 / 43691 FlyBaseID:FBgn0039828 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001017151.1 Gene:ebna1bp2 / 549905 XenbaseID:XB-GENE-998147 Length:308 Species:Xenopus tropicalis


Alignment Length:320 Identity:137/320 - (42%)
Similarity:190/320 - (59%) Gaps:38/320 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EDSA----SGYDSGDNSDAELQAAFERGDLKPGLNVEFNGQRDKVNDVTKLLAKTEAIKMQLPWL 67
            |||:    |.:|:.:.:|.|||.||.:|.|||||||...|::...|||:.|....:.:..:|||.
 Frog     5 EDSSPESDSDFDASELTDKELQEAFSQGKLKPGLNVILEGKKKPFNDVSGLRQSLKDLMNELPWA 69

  Fly    68 ERLDMINTLAPLAPELAVQLEKHEQKRANLFKGNAKLPYIRPEEDPVLNDFKREMLFHRQAQSAV 132
            ||:|:  |:.|:| |.|.|   :.|...|       .|.|..|:     ||:|||.|:||||:||
 Frog    70 ERMDV--TVDPVA-ETAGQ---NGQTAPN-------TPDINAED-----DFQREMCFYRQAQAAV 116

  Fly   133 LEAIPRLHELGIKTRRPDDYFAEMAKSDEHMQKVRANLMAKQQGQAKSERIKQIREQRKMGKMLA 197
            |.|:||||:|.:.|:|||||||||||:|:||||:|..|..||....|||:.||:|..||.||.:.
 Frog   117 LYALPRLHQLKVATKRPDDYFAEMAKTDQHMQKIRQKLQIKQAAMEKSEKAKQLRALRKYGKKVQ 181

  Fly   198 KQTKVQREAEKKDMLDKLKKFRKGKLKNLDFLE----------DAKALESKQKQSAENRKKRNKK 252
            .:...:|:.||..|:.::||::||....|||||          ...|.:..:|..:..|:.:::|
 Frog   182 TEVLQKRQKEKSAMMTQIKKYQKGLSDKLDFLEGDQTQKKNKTGGSAAQKAKKGPSAKRRYKDQK 246

  Fly   253 FGFGGKKKGLKRNTKSSSAGLDGDKSS------RRQRGVKAGASVNKRLGKSRRIKAKGR 306
            |||||||||.|||||.|...:.|.::|      :|:.|.|.|.:.|||.||..|.|.|.:
 Frog   247 FGFGGKKKGSKRNTKESYNDVSGFRASVAHGKGQRRPGKKGGKNANKRPGKKVRQKMKSK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1542NP_651850.1 Ebp2 20..299 CDD:283529 129/294 (44%)
ebna1bp2NP_001017151.1 Abhydrolase <8..70 CDD:304388 24/61 (39%)
Ebp2 22..298 CDD:283529 128/293 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2665
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4969
Inparanoid 1 1.050 225 1.000 Inparanoid score I3414
OMA 1 1.010 - - QHG56601
OrthoDB 1 1.010 - - D1154126at2759
OrthoFinder 1 1.000 - - FOG0004487
OrthoInspector 1 1.000 - - oto105595
Panther 1 1.100 - - LDO PTHR13028
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3179
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.