DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and RLP12

DIOPT Version :9

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_177296.2 Gene:RLP12 / 843481 AraportID:AT1G71400 Length:847 Species:Arabidopsis thaliana


Alignment Length:785 Identity:191/785 - (24%)
Similarity:309/785 - (39%) Gaps:137/785 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 VNSLQILDLSGNNLTKLHHKLFNNFDVLRVISMRDNKIKIQKPTETFNAVHYTLLKLDLSGDRND 413
            |.||.|.:...||..|.:..|| ....||.:.:.:..:..:.|:...|..|.||:.|..:....:
plant    86 VISLDIPNTFLNNYLKTNSSLF-KLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGE 149

  Fly   414 -PTNLQTLRKMR------NMRSLSI-SRLGSSSVGPEDFKDFGVELEDLQITRASLSGIQSHAFK 470
             |.::..|.::|      |:.:..| |.||:.|           .|.:|::....|.|....:..
plant   150 IPASIGNLNQLRHLILANNVLTGEIPSSLGNLS-----------RLVNLELFSNRLVGKIPDSIG 203

  Fly   471 HVRGLKRLDFSENGI-----SSIENDAFHEIGHSLISLKMSHGYSGSALPAEPLRHLTSLQELDF 530
            .::.|:.|..:.|.:     ||:.|.:      :|:.|.::|......:||. :.:|..|:.:.|
plant   204 DLKQLRNLSLASNNLIGEIPSSLGNLS------NLVHLVLTHNQLVGEVPAS-IGNLIELRVMSF 261

  Fly   531 SNNHISSMSDTSFHFLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQHTFFD 595
            .||.:|.....||..|..|.:..|..|......  .|...|...||...:.:|..:.....:...
plant   262 ENNSLSGNIPISFANLTKLSIFVLSSNNFTSTF--PFDMSIFHNLEYFDVSYNSFSGPFPKSLLL 324

  Fly   596 LEALRKLHLDDNKI-DKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEILDMAFNQLPN 659
            :.:|..::|.:|:. ..||.....:..:|:.|.|..|:::....||...|..||.||::.|   |
plant   325 IPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHN---N 386

  Fly   660 FNFDYFDQVGTLSN-LNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKILDLSHNNISIIHPGY 723
            |.......:..|.| |::::|.|.:...:....|            .:..:.||||:.|...  .
plant   387 FTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLW------------RLNTMVLSHNSFSSFE--N 437

  Fly   724 FRPAEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDAFKN----TKQLQLVFF 784
            ....|..:..|.|..||.......:...:..|.:||||.|..........:|    .|:|.|   
plant   438 TSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNL--- 499

  Fly   785 GHNYLSDIPQDIFKPVQGLRIVDFSHNHLRG-LPDNLFYNGGMEKLDVSHNMMLKIPSSSLSSLA 848
            |.|..|....|||.....|..:|.|||.|.| .|.:|.....:|.::|..|.:..|..|.|.||.
plant   500 GDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLP 564

  Fly   849 ALTLCELHLSNNFISTIHSMDLSNKFRSLRYLDISYNYLLRIDDAVFATMPKLAVLDLSHNRDLK 913
            :|.:..|. ||.|...::....|..|:|||.:|||:|..       ..|:|...   .|:.:|  
plant   565 SLHVLNLR-SNKFYGPLYHRHASIGFQSLRIIDISHNNF-------SGTLPPYY---FSNWKD-- 616

  Fly   914 VMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLREF-RLG---YNELPSIPQELAHNMS----- 969
                                  ::|:.|...:|:.|| |..   |:|:..:.:.:  :||     
plant   617 ----------------------MTTLTEEMDQYMTEFWRYADSYYHEMEMVNKGV--DMSFERIR 657

  Fly   970 -NLRMLDLSNNDLT-NVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDISNFRLHYF 1032
             :.|.:|.|.|.:. |:|.....|..||.|.||||..||:.......:.: ||.||||..:|.  
plant   658 RDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTK-LETLDISRNKLS-- 719

  Fly  1033 EYGCLDSLPHLRSLKLTAYSHLEHFNIPHLLRHHYNIRQLWIEAPQPFTRIVKKGSGPTQEMQTL 1097
                 ..:|.    .|.|.|.|.:.|..|.|          ::.|.|      :|:...::..:.
plant   720 -----GQIPQ----DLAALSFLSYMNFSHNL----------LQGPVP------RGTQFQRQKCSS 759

  Fly  1098 QLGNP 1102
            .|.||
plant   760 FLDNP 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566 11/36 (31%)
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380 7/22 (32%)
leucine-rich repeat 376..401 CDD:275380 5/24 (21%)
leucine-rich repeat 426..450 CDD:275378 5/24 (21%)
LRR_RI <448..651 CDD:238064 46/208 (22%)
leucine-rich repeat 451..474 CDD:275380 4/22 (18%)
LRR_8 473..559 CDD:290566 23/90 (26%)
leucine-rich repeat 475..524 CDD:275380 12/53 (23%)
leucine-rich repeat 500..519 CDD:275380 5/18 (28%)
leucine-rich repeat 525..548 CDD:275380 8/22 (36%)
leucine-rich repeat 549..574 CDD:275380 5/24 (21%)
LRR_8 573..633 CDD:290566 12/60 (20%)
leucine-rich repeat 575..598 CDD:275380 3/22 (14%)
leucine-rich repeat 599..622 CDD:275380 5/23 (22%)
LRR_8 622..683 CDD:290566 19/61 (31%)
leucine-rich repeat 623..646 CDD:275380 7/22 (32%)
leucine-rich repeat 647..730 CDD:275380 19/83 (23%)
leucine-rich repeat 648..673 CDD:275380 7/24 (29%)
leucine-rich repeat 674..705 CDD:275380 4/30 (13%)
LRR_8 704..763 CDD:290566 15/58 (26%)
leucine-rich repeat 731..754 CDD:275380 4/22 (18%)
LRR_8 753..813 CDD:290566 21/63 (33%)
leucine-rich repeat 755..778 CDD:275380 7/26 (27%)
leucine-rich repeat 779..802 CDD:275380 8/22 (36%)
leucine-rich repeat 803..823 CDD:275380 9/20 (45%)
leucine-rich repeat 852..876 CDD:275380 6/23 (26%)
LRR_8 854..910 CDD:290566 16/55 (29%)
LRR_RI <877..>1006 CDD:238064 34/139 (24%)
leucine-rich repeat 877..900 CDD:275380 7/22 (32%)
leucine-rich repeat 901..925 CDD:275380 2/23 (9%)
leucine-rich repeat 926..946 CDD:275380 2/19 (11%)
LRR_8 947..1004 CDD:290566 21/67 (31%)
leucine-rich repeat 947..970 CDD:275380 7/32 (22%)
leucine-rich repeat 971..993 CDD:275380 7/22 (32%)
LRR_8 992..1049 CDD:290566 17/56 (30%)
leucine-rich repeat 994..1014 CDD:275380 9/19 (47%)
leucine-rich repeat 1019..1042 CDD:275380 7/22 (32%)
RLP12NP_177296.2 LRRNT_2 36..80 CDD:285463
LRR_8 112..170 CDD:290566 12/57 (21%)
leucine-rich repeat 112..135 CDD:275380 4/22 (18%)
leucine-rich repeat 136..159 CDD:275380 5/22 (23%)
LRR_8 159..218 CDD:290566 14/69 (20%)
leucine-rich repeat 160..183 CDD:275380 7/33 (21%)
leucine-rich repeat 184..207 CDD:275380 4/22 (18%)
LRR_RI 198..479 CDD:238064 69/306 (23%)
LRR_8 206..266 CDD:290566 16/66 (24%)
leucine-rich repeat 208..231 CDD:275380 6/28 (21%)
leucine-rich repeat 232..255 CDD:275380 6/23 (26%)
leucine-rich repeat 256..279 CDD:275380 8/22 (36%)
leucine-rich repeat 280..352 CDD:275380 13/73 (18%)
leucine-rich repeat 304..322 CDD:275380 3/17 (18%)
LRR_8 351..411 CDD:290566 19/62 (31%)
leucine-rich repeat 353..376 CDD:275380 7/22 (32%)
LRR_RI 374..601 CDD:238064 70/247 (28%)
leucine-rich repeat 377..400 CDD:275380 8/25 (32%)
leucine-rich repeat 401..422 CDD:275380 4/32 (13%)
leucine-rich repeat 445..468 CDD:275380 4/22 (18%)
leucine-rich repeat 469..493 CDD:275380 7/23 (30%)
leucine-rich repeat 494..517 CDD:275380 9/25 (36%)
LRR_8 516..576 CDD:290566 21/60 (35%)
leucine-rich repeat 518..541 CDD:275380 9/22 (41%)
leucine-rich repeat 542..565 CDD:275380 8/22 (36%)
leucine-rich repeat 592..616 CDD:275380 9/33 (27%)
leucine-rich repeat 617..683 CDD:275380 17/67 (25%)
LRR_8 682..742 CDD:290566 24/81 (30%)
LRR_4 682..719 CDD:289563 15/37 (41%)
leucine-rich repeat 684..707 CDD:275380 9/22 (41%)
leucine-rich repeat 708..729 CDD:275380 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I2000
OMA 1 1.010 - - QHG54393
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.