DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and GHR1

DIOPT Version :9

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_001320016.1 Gene:GHR1 / 827842 AraportID:AT4G20940 Length:1037 Species:Arabidopsis thaliana


Alignment Length:692 Identity:150/692 - (21%)
Similarity:244/692 - (35%) Gaps:237/692 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 HLTSLQELDFSNNHISSMSDTSFHFLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHL 585
            :||.|.:|..|||.:|.:........|:|:.|:|.||.....|.......:  .|..:||..|:.
plant    76 NLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSV--SLRNLSLSGNNF 138

  Fly   586 TSISQHTFFDLEALRKLHLDDNKIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEIL 650
            :.....:...|.:|:.|.:..|.:.....::...|::|.||:|..|.........|:.:..||:|
plant   139 SGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMPRGFELISSLEVL 203

  Fly   651 DMAFNQLP-NFNFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKILDLSHN 714
            |:..|.:. |.:.::|                    |:.|:|:                :|:|.|
plant   204 DLHGNSIDGNLDGEFF--------------------LLTNASY----------------VDISGN 232

  Fly   715 NISIIHPGYFRP-AEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIH-ELDFDAFKNTK 777
            .: :...|...| ...|:.||:|.:|.|..:....|....:|:.||||||.:. ||.        
plant   233 RL-VTTSGKLLPGVSESIKHLNLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELP-------- 288

  Fly   778 QLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRG-LPDNLFYNGG--MEKLDVSHNMMLKI 839
                   |.||:.|           |.::..|:|...| ||:||.....  :..||:|.|.:   
plant   289 -------GFNYVYD-----------LEVLKLSNNRFSGSLPNNLLKGDSLLLTTLDLSGNNL--- 332

  Fly   840 PSSSLSSLAALTLCELHLSNNFIS--------TIHSMDLSN-----------KFRSLRYLDISYN 885
             |..:||:.:.||..|.||:|.::        ....:||||           |:.::.|||:|.|
plant   333 -SGPVSSIMSTTLHTLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNLTRWSKWENIEYLDLSQN 396

  Fly   886 YLLRIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLR-- 948
            :                                |.|                :.|:...:.||  
plant   397 H--------------------------------FTG----------------SFPDATPQLLRAN 413

  Fly   949 EFRLGYNELP-SIPQELAHNMSNLRMLDLSNNDLTN-VPLMTQALPHLRRLMLSGNPITSLNNNS 1011
            ...|.||:|. |:|:.:..:...||:||:|:|.|.. :|....::|.|..:.|..|.:|. |...
plant   414 HLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQNNGMTG-NIGP 477

  Fly  1012 FDGVNEDLEMLDISNFRLHYFEYGCLDSLPHLRSLKLTAYSHLEHFNIPHLLRHHYNIRQLWIEA 1076
            .......:.:||:|:.|......|...||.:|:.|.|.|                          
plant   478 LPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAA-------------------------- 516

  Fly  1077 PQPFTRIVKKGSGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNIT-----------FSGPQFTNL 1130
                                          ..:.|.|||.:.:|.           |:||..:||
plant   517 ------------------------------NNLSGSLPSSMNDIVSLSSLDVSQNHFTGPLPSNL 551

  Fly  1131 NERILRGMRSPYLYMQLFNTSLQAL------------PPNFF 1160
            :..|:           .||.|...|            ||:|:
plant   552 SSNIM-----------AFNVSYNDLSGTVPENLKNFPPPSFY 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
LRR_RI <448..651 CDD:238064 32/129 (25%)
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:290566 14/37 (38%)
leucine-rich repeat 475..524 CDD:275380 1/2 (50%)
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380 6/22 (27%)
leucine-rich repeat 549..574 CDD:275380 6/24 (25%)
LRR_8 573..633 CDD:290566 14/59 (24%)
leucine-rich repeat 575..598 CDD:275380 5/22 (23%)
leucine-rich repeat 599..622 CDD:275380 4/22 (18%)
LRR_8 622..683 CDD:290566 13/61 (21%)
leucine-rich repeat 623..646 CDD:275380 6/22 (27%)
leucine-rich repeat 647..730 CDD:275380 15/84 (18%)
leucine-rich repeat 648..673 CDD:275380 6/25 (24%)
leucine-rich repeat 674..705 CDD:275380 3/30 (10%)
LRR_8 704..763 CDD:290566 17/59 (29%)
leucine-rich repeat 731..754 CDD:275380 6/22 (27%)
LRR_8 753..813 CDD:290566 16/60 (27%)
leucine-rich repeat 755..778 CDD:275380 9/23 (39%)
leucine-rich repeat 779..802 CDD:275380 4/22 (18%)
leucine-rich repeat 803..823 CDD:275380 8/20 (40%)
leucine-rich repeat 852..876 CDD:275380 10/42 (24%)
LRR_8 854..910 CDD:290566 14/74 (19%)
LRR_RI <877..>1006 CDD:238064 28/132 (21%)
leucine-rich repeat 877..900 CDD:275380 5/22 (23%)
leucine-rich repeat 901..925 CDD:275380 2/23 (9%)
leucine-rich repeat 926..946 CDD:275380 1/19 (5%)
LRR_8 947..1004 CDD:290566 20/60 (33%)
leucine-rich repeat 947..970 CDD:275380 8/25 (32%)
leucine-rich repeat 971..993 CDD:275380 8/22 (36%)
LRR_8 992..1049 CDD:290566 15/56 (27%)
leucine-rich repeat 994..1014 CDD:275380 5/19 (26%)
leucine-rich repeat 1019..1042 CDD:275380 7/22 (32%)
GHR1NP_001320016.1 PLN00113 2..1036 CDD:215061 150/692 (22%)
leucine-rich repeat 80..103 CDD:275380 6/22 (27%)
leucine-rich repeat 104..127 CDD:275380 6/24 (25%)
leucine-rich repeat 128..151 CDD:275380 5/22 (23%)
leucine-rich repeat 152..175 CDD:275380 4/22 (18%)
leucine-rich repeat 176..199 CDD:275380 6/22 (27%)
leucine-rich repeat 200..223 CDD:275380 8/42 (19%)
leucine-rich repeat 224..248 CDD:275380 6/40 (15%)
leucine-rich repeat 249..272 CDD:275380 6/22 (27%)
leucine-rich repeat 296..314 CDD:275380 6/17 (35%)
leucine-rich repeat 344..387 CDD:275380 10/42 (24%)
leucine-rich repeat 388..412 CDD:275380 9/71 (13%)
leucine-rich repeat 413..436 CDD:275380 6/22 (27%)
leucine-rich repeat 437..460 CDD:275380 8/22 (36%)
leucine-rich repeat 461..484 CDD:275380 5/23 (22%)
leucine-rich repeat 485..508 CDD:275380 7/22 (32%)
leucine-rich repeat 509..532 CDD:275380 9/78 (12%)
leucine-rich repeat 533..553 CDD:275380 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.