DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and LRRC4

DIOPT Version :9

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_071426.1 Gene:LRRC4 / 64101 HGNCID:15586 Length:653 Species:Homo sapiens


Alignment Length:657 Identity:140/657 - (21%)
Similarity:239/657 - (36%) Gaps:182/657 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 SSSVGPEDFKDF---GVELEDLQITRASLS----GIQSHAFKHVRGLKRLDFSENGISSIENDAF 493
            ::|.||::....   ..:...:..||..||    ||.|:.       :.|:..||.|..|:.|.|
Human    38 AASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNT-------RYLNLMENNIQMIQADTF 95

  Fly   494 HEIGHSLISLKMSHGYSGSALPAEPLRHLTSLQELDFSNNHISSMSDTSFHFLKNLRLLELHDNR 558
                                      |||..|:.|....|.|..:...:|:.|.:|..|||.||.
Human    96 --------------------------RHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNW 134

  Fly   559 IEQVLKGTFQGDIHSKLEEISLRFNHLTSISQHTFFDLEALRKLHLDD-NKIDKIERRAFMNLDE 622
            :..:..|.|  :..|||.|:.||.|.:.||..:.|..:.:|.:|.|.: .|::.|...||..|..
Human   135 LTVIPSGAF--EYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFN 197

  Fly   623 LEYLSLRGNKINNLADESFQNLPKLEILDMAFNQLPNFNFDYFDQVGTLSNLNVNVSHNQIRQLM 687
            |:||:|....|.::  .:...|..||.|:|:.|..|......|..:.:|..|  .|.::|:    
Human   198 LKYLNLGMCNIKDM--PNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKL--WVMNSQV---- 254

  Fly   688 YNSSWSGRNEHGGMYHSNIKILDLSHNNISIIHPGYFRPAEISLTHLHLGYNSLMNTTRDVFGNM 752
               |...||...|:  :::..|:|:|||:|.:....|.|... |..|||.:|. .|...|:.   
Human   255 ---SLIERNAFDGL--ASLVELNLAHNNLSSLPHDLFTPLRY-LVELHLHHNP-WNCDCDIL--- 309

  Fly   753 PHLQW-------------------LDLSYNWIHELDFDAFKNTKQLQLVFFGHNYLSDIPQDIFK 798
             .|.|                   :.:...::.|:|..:|:.:..         ::.|.|:|   
Human   310 -WLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAP---------FIMDAPRD--- 361

  Fly   799 PVQGLRIVDFSHNHLRGLPDNLFYNGGMEKLDVSHNMM--LKIPSSSLSSLAALTLCELHLSNNF 861
                                          |::|...|  ||..:..:||:..|      |.|..
Human   362 ------------------------------LNISEGRMAELKCRTPPMSSVKWL------LPNGT 390

  Fly   862 ISTIHSMDLSNKFRSLRYL-----DISYNYLLRIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMG 921
            :       ||:..|..|..     .::::::|..|..|:..|    |.:::.|.:....      
Human   391 V-------LSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCM----VTNVAGNSNASAY------ 438

  Fly   922 LENSLIKLGLENISLSTVPEIRLKYL--REFRLGYNELP--SIPQELAHNMSNLRMLDLSNNDLT 982
            |..|..:|...|.|..|...:....:  .:....|..:|  |...:.|:..|            |
Human   439 LNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTS------------T 491

  Fly   983 NVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDISNFRLHYFEYGCLDSLPHLRSLK 1047
            .|.:.|..:|  :::.:.....|.....|.|.|.:..:::           .||..::..|.:..
Human   492 TVLIQTTRVP--KQVAVPATDTTDKMQTSLDEVMKTTKII-----------IGCFVAVTLLAAAM 543

  Fly  1048 LTAYSHL 1054
            |..:..|
Human   544 LIVFYKL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378 3/16 (19%)
LRR_RI <448..651 CDD:238064 57/207 (28%)
leucine-rich repeat 451..474 CDD:275380 7/26 (27%)
LRR_8 473..559 CDD:290566 22/85 (26%)
leucine-rich repeat 475..524 CDD:275380 10/48 (21%)
leucine-rich repeat 500..519 CDD:275380 0/18 (0%)
leucine-rich repeat 525..548 CDD:275380 6/22 (27%)
leucine-rich repeat 549..574 CDD:275380 8/24 (33%)
LRR_8 573..633 CDD:290566 22/60 (37%)
leucine-rich repeat 575..598 CDD:275380 8/22 (36%)
leucine-rich repeat 599..622 CDD:275380 8/23 (35%)
LRR_8 622..683 CDD:290566 16/60 (27%)
leucine-rich repeat 623..646 CDD:275380 6/22 (27%)
leucine-rich repeat 647..730 CDD:275380 23/82 (28%)
leucine-rich repeat 648..673 CDD:275380 7/24 (29%)
leucine-rich repeat 674..705 CDD:275380 7/30 (23%)
LRR_8 704..763 CDD:290566 17/77 (22%)
leucine-rich repeat 731..754 CDD:275380 7/22 (32%)
LRR_8 753..813 CDD:290566 8/78 (10%)
leucine-rich repeat 755..778 CDD:275380 5/41 (12%)
leucine-rich repeat 779..802 CDD:275380 3/22 (14%)
leucine-rich repeat 803..823 CDD:275380 0/19 (0%)
leucine-rich repeat 852..876 CDD:275380 4/23 (17%)
LRR_8 854..910 CDD:290566 11/60 (18%)
LRR_RI <877..>1006 CDD:238064 22/137 (16%)
leucine-rich repeat 877..900 CDD:275380 5/27 (19%)
leucine-rich repeat 901..925 CDD:275380 3/23 (13%)
leucine-rich repeat 926..946 CDD:275380 4/19 (21%)
LRR_8 947..1004 CDD:290566 9/60 (15%)
leucine-rich repeat 947..970 CDD:275380 4/26 (15%)
leucine-rich repeat 971..993 CDD:275380 3/21 (14%)
LRR_8 992..1049 CDD:290566 8/56 (14%)
leucine-rich repeat 994..1014 CDD:275380 2/19 (11%)
leucine-rich repeat 1019..1042 CDD:275380 2/22 (9%)
LRRC4NP_071426.1 LRRNT 46..79 CDD:214470 7/39 (18%)
LRR <74..291 CDD:227223 72/264 (27%)
LRR 1 76..97 7/53 (13%)
leucine-rich repeat 77..100 CDD:275380 10/55 (18%)
LRR 2 100..121 5/20 (25%)
leucine-rich repeat 101..124 CDD:275380 6/22 (27%)
LRR 3 124..145 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 8/24 (33%)
LRR 4 148..169 9/20 (45%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
LRR 5 172..194 7/21 (33%)
leucine-rich repeat 173..197 CDD:275380 8/23 (35%)
LRR 6 197..218 5/22 (23%)
leucine-rich repeat 198..219 CDD:275380 6/22 (27%)
LRR 7 219..240 7/20 (35%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
LRR 8 243..264 7/29 (24%)
leucine-rich repeat 244..267 CDD:275380 8/33 (24%)
LRR 9 267..288 7/20 (35%)
leucine-rich repeat 268..289 CDD:275380 7/20 (35%)
LRRCT 300..351 CDD:214507 8/55 (15%)
IG 359..441 CDD:214652 23/137 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24369
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.