DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and lrrc4.2

DIOPT Version :9

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_001093494.1 Gene:lrrc4.2 / 566572 ZFINID:ZDB-GENE-030131-7997 Length:644 Species:Danio rerio


Alignment Length:573 Identity:121/573 - (21%)
Similarity:201/573 - (35%) Gaps:193/573 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 MSHGYSGSALPAEPLRHLTSLQELDFSNNHISSMSDTSFHFLK-------NLRLLELHDNRIEQV 562
            |...:|.||.|:..|    :...:.|.:|..:.:..|....::       ..|.|.|.:|.||.:
Zfish    24 MVRSWSVSAAPSGQL----TCPSVCFCSNVSNKVVCTRRSLVRVPPGIPATTRHLNLMENSIETI 84

  Fly   563 LKGTFQGDIHSKLEEISLRFNHLTSISQHTFFDLEALRKLHLDDNKIDKIERRAFMNLDELEYLS 627
            ..||||...|  ||.:.|..|.:..|....|..|.:|..|.|.||::..|...||..|.:|..|.
Zfish    85 EAGTFQHLRH--LEVLQLGRNSIRQIEVGAFSGLNSLNTLELFDNRLTVIPSGAFEYLSKLRELW 147

  Fly   628 LRGNKINNLADESFQNLPKLEILDMAFNQLPNFNFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSW 692
            ||.|.|.::...:|..:|.|..||:                            .::|:|.|.|..
Zfish   148 LRSNPIESIPSYAFNRVPSLMRLDL----------------------------GELRKLEYISEG 184

  Fly   693 SGRNEHGGMYHSNIKILDLSHNNI---SIIHPGYFRPAEISLTHLHLGYNSLMNTTRDVFGNMPH 754
            :....|      |:|.|:|...|:   .::.|                              :..
Zfish   185 AFEGLH------NLKYLNLGMCNLREMPVLTP------------------------------LVG 213

  Fly   755 LQWLDLSYNWIHELDFDAFKNTKQLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDN 819
            |:.|::|.|:..||...:|:..|.|:.::..::.::.|.::.|..|..|..::.:||:|..||.:
Zfish   214 LEELEMSENYFPELKPGSFRGLKSLKKLWIMNSRITTIERNAFDDVTALVELNLAHNNLSSLPHD 278

  Fly   820 LFYNGGMEKLDVSHNMMLKIPSSSLSSLAALT-LCELHLSNN-----------------FISTIH 866
            ||                          |.|: |.||||.:|                 :|.|  
Zfish   279 LF--------------------------APLSYLVELHLHHNPWRCDCDVVWLAWWLREYIPT-- 315

  Fly   867 SMDLSNKFRSLRYLDISYNYLLRIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGL 931
            :.....:..:..||  ...||:.:|.:.|...... :||..  |||                   
Zfish   316 NSTCCGRCHTPAYL--RGRYLVEVDQSTFQCSAPF-ILDAP--RDL------------------- 356

  Fly   932 ENISLSTVPEIRLKYLREFRLGYNELPSIPQELAHNMSNLRMLDLSNNDLTNVPLMTQALPHLRR 996
             |||...|.|::.:             :.|      ||::|.|      |.|..::|....|.|.
Zfish   357 -NISAERVAELKCR-------------TAP------MSSVRWL------LPNGTVLTHGSNHPRI 395

  Fly   997 LMLSGNP-----------------ITSLNNNSFDGVNEDLEMLDISNFRLHYF 1032
            .:|:...                 :|::..||......::...:::...|.||
Zfish   396 SVLNDGTLNFSNVLPADTGVYTCMVTNMAGNSNASAYLNVTAAELNTSNLSYF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
LRR_RI <448..651 CDD:238064 45/152 (30%)
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:290566 13/60 (22%)
leucine-rich repeat 475..524 CDD:275380 6/18 (33%)
leucine-rich repeat 500..519 CDD:275380 5/13 (38%)
leucine-rich repeat 525..548 CDD:275380 3/29 (10%)
leucine-rich repeat 549..574 CDD:275380 11/24 (46%)
LRR_8 573..633 CDD:290566 21/59 (36%)
leucine-rich repeat 575..598 CDD:275380 7/22 (32%)
leucine-rich repeat 599..622 CDD:275380 9/22 (41%)
LRR_8 622..683 CDD:290566 11/60 (18%)
leucine-rich repeat 623..646 CDD:275380 7/22 (32%)
leucine-rich repeat 647..730 CDD:275380 14/85 (16%)
leucine-rich repeat 648..673 CDD:275380 2/24 (8%)
leucine-rich repeat 674..705 CDD:275380 5/30 (17%)
LRR_8 704..763 CDD:290566 9/61 (15%)
leucine-rich repeat 731..754 CDD:275380 0/22 (0%)
LRR_8 753..813 CDD:290566 15/59 (25%)
leucine-rich repeat 755..778 CDD:275380 7/22 (32%)
leucine-rich repeat 779..802 CDD:275380 4/22 (18%)
leucine-rich repeat 803..823 CDD:275380 8/19 (42%)
leucine-rich repeat 852..876 CDD:275380 8/40 (20%)
LRR_8 854..910 CDD:290566 15/72 (21%)
LRR_RI <877..>1006 CDD:238064 27/145 (19%)
leucine-rich repeat 877..900 CDD:275380 6/22 (27%)
leucine-rich repeat 901..925 CDD:275380 5/23 (22%)
leucine-rich repeat 926..946 CDD:275380 5/19 (26%)
LRR_8 947..1004 CDD:290566 11/73 (15%)
leucine-rich repeat 947..970 CDD:275380 2/22 (9%)
leucine-rich repeat 971..993 CDD:275380 5/21 (24%)
LRR_8 992..1049 CDD:290566 9/58 (16%)
leucine-rich repeat 994..1014 CDD:275380 5/36 (14%)
leucine-rich repeat 1019..1042 CDD:275380 3/14 (21%)
lrrc4.2NP_001093494.1 leucine-rich repeat 71..94 CDD:275380 10/22 (45%)
LRR_8 72..129 CDD:290566 23/58 (40%)
LRR_RI 74..>276 CDD:238064 64/267 (24%)
leucine-rich repeat 95..118 CDD:275380 7/22 (32%)
leucine-rich repeat 119..142 CDD:275380 9/22 (41%)
LRR_8 141..202 CDD:290566 20/94 (21%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..191 CDD:275380 8/57 (14%)
leucine-rich repeat 192..213 CDD:275380 5/50 (10%)
LRR_8 213..272 CDD:290566 15/58 (26%)
leucine-rich repeat 214..237 CDD:275380 7/22 (32%)
leucine-rich repeat 238..261 CDD:275380 4/22 (18%)
leucine-rich repeat 262..283 CDD:275380 9/46 (20%)
LRRCT 294..345 CDD:214507 9/54 (17%)
IG_like 353..435 CDD:214653 22/128 (17%)
Ig 365..435 CDD:299845 15/94 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24369
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.