DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and LOC4576240

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:XP_001237076.3 Gene:LOC4576240 / 4576240 VectorBaseID:AGAMI1_014008 Length:410 Species:Anopheles gambiae


Alignment Length:260 Identity:60/260 - (23%)
Similarity:112/260 - (43%) Gaps:80/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 NGGMEKLDVSHNMMLKIPS--SSLSSLAALTL--CELHLSNNFISTIHSMDLSNKFRSLRYLDIS 883
            |..:|...:...::.::|.  |.::.|.:.::  |.|        |:..:|:..:.::|.|||:|
Mosquito   110 NVNLESFSIEQCLIDRLPPTLSKMTRLKSFSIRRCML--------TVLRLDMFVENQNLNYLDLS 166

  Fly   884 YN---------------------YLL-----RIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGL 922
            ||                     ||.     |:|.|||..||.|:.|.::.|| :..:|.|    
Mosquito   167 YNQIRQLIPITGRPARMLSIAKLYLAGNVLERLDMAVFVAMPLLSELYITDNR-IVTLDVS---- 226

  Fly   923 ENSLIKLGLENISLSTVPEIRLKYLREFRLGYN---ELPSIPQEL---------AHNMS------ 969
                :.|.|.|:   |:|::     ..|..|.|   ::|.:|:.:         |:|::      
Mosquito   227 ----VSLDLRNL---TLPKV-----ETFSFGPNALTQMPILPRLMPKFNYISLFANNLTQLDMTY 279

  Fly   970 -----NLRMLDLSNNDLTNVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDISNFRL 1029
                 ||:.:.:::|.:|.|...:.....|..|:|:.|.||:.|...:|..|  :.:|::...||
Mosquito   280 FRPYPNLQKIYITSNQITTVRASSPVRLPLVHLVLTDNKITTFNITGWDMPN--ITLLNLDGNRL 342

  Fly  1030  1029
            Mosquito   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
LRR <540..>834 CDD:443914 2/10 (20%)
leucine-rich repeat 549..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR <730..1081 CDD:443914 60/260 (23%)
leucine-rich repeat 731..754 CDD:275380
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 803..823 CDD:275380 60/260 (23%)
leucine-rich repeat 852..876 CDD:275380 4/25 (16%)
leucine-rich repeat 877..900 CDD:275380 15/48 (31%)
leucine-rich repeat 901..925 CDD:275380 6/23 (26%)
leucine-rich repeat 926..946 CDD:275380 5/19 (26%)
leucine-rich repeat 947..970 CDD:275380 7/45 (16%)
leucine-rich repeat 971..993 CDD:275380 4/21 (19%)
leucine-rich repeat 994..1014 CDD:275380 7/19 (37%)
leucine-rich repeat 1019..1042 CDD:275380 3/11 (27%)
LOC4576240XP_001237076.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.