DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and cDIP

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:463 Identity:116/463 - (25%)
Similarity:191/463 - (41%) Gaps:107/463 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 ILDLSHNNISIIHPGYFRPAEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDA 772
            ||.||.|:|.::....||.|. :|..:.|..|.|.......|.|:..||:|||:.|.:..|..|.
  Fly   145 ILLLSDNHIEVLPTKTFRGAG-NLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENRLEALAADV 208

  Fly   773 FKNTKQLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLFYNGG----MEKLDVSH 833
            |...|.|:.|....|.|:.|..|:|.....|..|...:|.||.:.:..|.:.|    |:.:|:|:
  Fly   209 FAGLKSLRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSN 273

  Fly   834 N-----MMLKIPSSSLSSLAALTLCELHLSNNFISTIHSMDLS-NKFR--------SLRYLDISY 884
            |     ::|.|.:::|::    ..|.|...|.: .::.::||| |:.|        :|.:|.:..
  Fly   274 NPELVVLLLNINATNLTA----RNCSLDRVNLY-GSVTNVDLSDNRVRELYFPASEALEHLVLRN 333

  Fly   885 NYLLRIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLRE 949
            |.|:::  |..:.:|:|..||::.|.:|..:...:                  ..|.:.:..|| 
  Fly   334 NSLVQL--ASLSRVPRLRHLDVADNPNLGQLPDGW------------------RTPHLEMLVLR- 377

  Fly   950 FRLGYNELPSIPQELAHNMSNLRMLDLSNNDLTNV-----PLMTQALPHLRRLMLSGNPITSLNN 1009
             ..|..||   |.|....|.||:.||:|.|:||.:     |.:||    |....:.||     |.
  Fly   378 -NTGQMEL---PLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQ----LTHFYIHGN-----NW 429

  Fly  1010 NSF------------DGVNEDLEMLDISNFRLHYFE-YGCLDSLPHLRSLKLTAYSHLEHFNIPH 1061
            |.|            :|:...::..| .:|...||. ..|:..||....:..::.|.:       
  Fly   430 NCFSLRNIMDVLIRANGIAYTVDNYD-PDFPGEYFHGIACMYRLPEKEGVDSSSSSEI------- 486

  Fly  1062 LLRHHYNIRQLWIEAPQPFTRIVKKGSGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNITFSGPQ 1126
                     ...:|: .|.|     .|....|:..|:     |..:.:..|..||. ::.||  :
  Fly   487 ---------SASVES-SPIT-----SSSDPSEVDKLR-----DELKAVVQHFDSKF-DLIFS--K 528

  Fly  1127 FTNLNERI 1134
            ...|||:|
  Fly   529 LAQLNEQI 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380
LRR_8 473..559 CDD:404697
leucine-rich repeat 475..524 CDD:275380
leucine-rich repeat 500..519 CDD:275380
leucine-rich repeat 525..548 CDD:275380
LRR <540..>834 CDD:443914 42/129 (33%)
leucine-rich repeat 549..574 CDD:275380
leucine-rich repeat 575..598 CDD:275380
leucine-rich repeat 599..622 CDD:275380
leucine-rich repeat 623..646 CDD:275380
leucine-rich repeat 647..730 CDD:275380 9/21 (43%)
leucine-rich repeat 648..673 CDD:275380
leucine-rich repeat 674..705 CDD:275380
LRR <730..1081 CDD:443914 93/386 (24%)
leucine-rich repeat 731..754 CDD:275380 6/22 (27%)
leucine-rich repeat 755..778 CDD:275380 9/22 (41%)
leucine-rich repeat 779..802 CDD:275380 7/22 (32%)
leucine-rich repeat 803..823 CDD:275380 6/19 (32%)
leucine-rich repeat 852..876 CDD:275380 8/32 (25%)
leucine-rich repeat 877..900 CDD:275380 5/22 (23%)
leucine-rich repeat 901..925 CDD:275380 5/23 (22%)
leucine-rich repeat 926..946 CDD:275380 1/19 (5%)
leucine-rich repeat 947..970 CDD:275380 8/22 (36%)
leucine-rich repeat 971..993 CDD:275380 10/26 (38%)
leucine-rich repeat 994..1014 CDD:275380 6/31 (19%)
leucine-rich repeat 1019..1042 CDD:275380 6/23 (26%)
cDIPNP_650951.1 LRR 107..>410 CDD:443914 82/295 (28%)
leucine-rich repeat 118..142 CDD:275380
leucine-rich repeat 143..166 CDD:275380 9/21 (43%)
leucine-rich repeat 167..190 CDD:275380 6/22 (27%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..238 CDD:275380 7/22 (32%)
leucine-rich repeat 239..265 CDD:275380 7/25 (28%)
leucine-rich repeat 266..325 CDD:275380 15/63 (24%)
leucine-rich repeat 326..347 CDD:275380 5/22 (23%)
leucine-rich repeat 348..394 CDD:275380 14/68 (21%)
leucine-rich repeat 395..418 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.