DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and CG16974

DIOPT Version :10

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_609610.2 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:656 Identity:156/656 - (23%)
Similarity:269/656 - (41%) Gaps:147/656 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 GLKRLDFSENGISSIENDAFHEIGHSLISLKMSHGYSGSALPAEPLRH-------LTSLQELDFS 531
            |||       ..::|..|:    .|.|.:...:..|    |...|.:|       :.:.||.:| 
  Fly    17 GLK-------AAAAISGDS----THCLATYSSAEAY----LAQIPQQHRPQIRPRIRTWQEHEF- 65

  Fly   532 NNHISSMSDTSFH--FLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQ---- 590
                 |:....||  |:.:....:|.|:..::   |.:.....:..|.:.:..:.|.|:..    
  Fly    66 -----SLLGYKFHLPFVGHAVDSDLDDSDSDE---GLWLDAADAGSESVEVEEHELPSVGHVDPT 122

  Fly   591 -HTFFDLEALRKLHLDDNKIDK---IERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLE--- 648
             :.|    .|...|:|..::::   .:|.:.:|.::|....:..::.|.|      .||:||   
  Fly   123 GNVF----KLNCEHVDLRRVNQELLSQRSSHINYNQLMLAHVPADRSNPL------KLPQLESLR 177

  Fly   649 -------------ILDMAFNQLPNFNFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGG 700
                         :::: |.:.|. :|:|.::        :|::.|::..|.:....:.|     
  Fly   178 EFSWQSSELKDETLMEL-FTRQPR-SFEYMER--------LNLAENRLECLHWAIPLAVR----- 227

  Fly   701 MYHSNIKILDLSHN---NISIIHPGYFRPAEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSY 762
                .:|:|::|.|   |.|:::..|.:    .|..|||..:.|....:...|.:..|:.|:||.
  Fly   228 ----RVKVLEMSGNRLSNCSLLNLQYMK----QLQELHLDRSELTYLPQRFLGELSELRMLNLSQ 284

  Fly   763 NWIHELDFDAFKNTKQLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLF-YNGGM 826
            |.:.||..|.|....:|:.::...|.||.:|..:|:....|:::|.|.|.|...|||.| .||.:
  Fly   285 NLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQL 349

  Fly   827 EKLDVSHNMMLKIPSSSLSSLAALTLCELHLSNNFISTIHSMDLSNKFRSLRY---LDISYNYLL 888
            .:|.:..|.:..|...||.||..|.  :|.||.|.:|.|.    ...|.||.:   |::|.|.|.
  Fly   350 RQLHLQRNQLKSIGKHSLYSLRELR--QLDLSQNSLSVID----RKAFESLDHLLALNVSGNNLT 408

  Fly   889 RIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTV-------------P 940
            .:...:|.::..|..||||.|: .|.:.......:.||:.|.::...:...             |
  Fly   409 LLSSIIFQSLHALRQLDLSRNQ-FKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDP 472

  Fly   941 EI--RLKYL---REFRLGYNELPSIPQELAHNMSNLRMLDLSNNDLTNVPLMTQALPHLRRLMLS 1000
            ::  ||:||   :..:|.|     :|..|..|..|:|.|.|:.|.|..:|.....|..|:||.:.
  Fly   473 QVLHRLRYLSVQQNRKLTY-----LPATLFANTPNIRELLLAENGLLQLPTQISGLSRLQRLSVR 532

  Fly  1001 GNPITSLNNNSFDGVNEDLEMLDISNFR-LHYF-----EYGCLDSLPHLRSLKLTAYSHLEHFNI 1059
            ||.:.||..|             |...| |||.     ||.|..|:..|.:......:.|.| .:
  Fly   533 GNSLGSLPEN-------------IKELRQLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRH-QM 583

  Fly  1060 PHLLRH 1065
            |....|
  Fly   584 PQAQNH 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 LRR <84..320 CDD:443914
leucine-rich repeat 84..103 CDD:275380
leucine-rich repeat 104..128 CDD:275380
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
PPP1R42 355..564 CDD:455733 20/98 (20%)
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
leucine-rich repeat 451..474 CDD:275380 156/656 (24%)
LRR_8 473..559 CDD:404697 20/93 (22%)
leucine-rich repeat 475..524 CDD:275380 10/55 (18%)
leucine-rich repeat 500..519 CDD:275380 3/18 (17%)
leucine-rich repeat 525..548 CDD:275380 7/24 (29%)
LRR <540..>834 CDD:443914 70/323 (22%)
leucine-rich repeat 549..574 CDD:275380 3/24 (13%)
leucine-rich repeat 575..598 CDD:275380 4/27 (15%)
leucine-rich repeat 599..622 CDD:275380 5/25 (20%)
leucine-rich repeat 623..646 CDD:275380 4/22 (18%)
leucine-rich repeat 647..730 CDD:275380 17/101 (17%)
leucine-rich repeat 648..673 CDD:275380 5/40 (13%)
leucine-rich repeat 674..705 CDD:275380 4/30 (13%)
LRR <730..1081 CDD:443914 104/364 (29%)
leucine-rich repeat 731..754 CDD:275380 6/22 (27%)
leucine-rich repeat 755..778 CDD:275380 9/22 (41%)
leucine-rich repeat 779..802 CDD:275380 6/22 (27%)
leucine-rich repeat 803..823 CDD:275380 9/20 (45%)
leucine-rich repeat 852..876 CDD:275380 7/23 (30%)
leucine-rich repeat 877..900 CDD:275380 6/25 (24%)
leucine-rich repeat 901..925 CDD:275380 7/23 (30%)
leucine-rich repeat 926..946 CDD:275380 5/34 (15%)
leucine-rich repeat 947..970 CDD:275380 6/25 (24%)
leucine-rich repeat 971..993 CDD:275380 7/21 (33%)
leucine-rich repeat 994..1014 CDD:275380 8/19 (42%)
leucine-rich repeat 1019..1042 CDD:275380 9/28 (32%)
CG16974NP_609610.2 leucine-rich repeat 206..228 CDD:275380 4/38 (11%)
leucine-rich repeat 229..252 CDD:275380 7/26 (27%)
LRR <230..531 CDD:443914 92/316 (29%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..348 CDD:275380 10/22 (45%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
leucine-rich repeat 373..396 CDD:275380 10/28 (36%)
leucine-rich repeat 397..420 CDD:275380 5/22 (23%)
leucine-rich repeat 421..444 CDD:275380 7/23 (30%)
leucine-rich repeat 478..502 CDD:275380 8/28 (29%)
leucine-rich repeat 503..526 CDD:275380 7/22 (32%)
Ig <714..761 CDD:472250
Ig strand C 714..718 CDD:409358
Ig strand E 734..738 CDD:409358
Ig strand F 748..753 CDD:409358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.