DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chp and CG16974

DIOPT Version :9

Sequence 1:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster
Sequence 2:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:656 Identity:156/656 - (23%)
Similarity:269/656 - (41%) Gaps:147/656 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 GLKRLDFSENGISSIENDAFHEIGHSLISLKMSHGYSGSALPAEPLRH-------LTSLQELDFS 531
            |||       ..::|..|:    .|.|.:...:..|    |...|.:|       :.:.||.:| 
  Fly    17 GLK-------AAAAISGDS----THCLATYSSAEAY----LAQIPQQHRPQIRPRIRTWQEHEF- 65

  Fly   532 NNHISSMSDTSFH--FLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQ---- 590
                 |:....||  |:.:....:|.|:..::   |.:.....:..|.:.:..:.|.|:..    
  Fly    66 -----SLLGYKFHLPFVGHAVDSDLDDSDSDE---GLWLDAADAGSESVEVEEHELPSVGHVDPT 122

  Fly   591 -HTFFDLEALRKLHLDDNKIDK---IERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLE--- 648
             :.|    .|...|:|..::::   .:|.:.:|.::|....:..::.|.|      .||:||   
  Fly   123 GNVF----KLNCEHVDLRRVNQELLSQRSSHINYNQLMLAHVPADRSNPL------KLPQLESLR 177

  Fly   649 -------------ILDMAFNQLPNFNFDYFDQVGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGG 700
                         :::: |.:.|. :|:|.::        :|::.|::..|.:....:.|     
  Fly   178 EFSWQSSELKDETLMEL-FTRQPR-SFEYMER--------LNLAENRLECLHWAIPLAVR----- 227

  Fly   701 MYHSNIKILDLSHN---NISIIHPGYFRPAEISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSY 762
                .:|:|::|.|   |.|:::..|.:    .|..|||..:.|....:...|.:..|:.|:||.
  Fly   228 ----RVKVLEMSGNRLSNCSLLNLQYMK----QLQELHLDRSELTYLPQRFLGELSELRMLNLSQ 284

  Fly   763 NWIHELDFDAFKNTKQLQLVFFGHNYLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLF-YNGGM 826
            |.:.||..|.|....:|:.::...|.||.:|..:|:....|:::|.|.|.|...|||.| .||.:
  Fly   285 NLLTELPRDIFVGALKLERLYLSGNRLSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQL 349

  Fly   827 EKLDVSHNMMLKIPSSSLSSLAALTLCELHLSNNFISTIHSMDLSNKFRSLRY---LDISYNYLL 888
            .:|.:..|.:..|...||.||..|.  :|.||.|.:|.|.    ...|.||.:   |::|.|.|.
  Fly   350 RQLHLQRNQLKSIGKHSLYSLRELR--QLDLSQNSLSVID----RKAFESLDHLLALNVSGNNLT 408

  Fly   889 RIDDAVFATMPKLAVLDLSHNRDLKVMDKSFMGLENSLIKLGLENISLSTV-------------P 940
            .:...:|.::..|..||||.|: .|.:.......:.||:.|.::...:...             |
  Fly   409 LLSSIIFQSLHALRQLDLSRNQ-FKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDP 472

  Fly   941 EI--RLKYL---REFRLGYNELPSIPQELAHNMSNLRMLDLSNNDLTNVPLMTQALPHLRRLMLS 1000
            ::  ||:||   :..:|.|     :|..|..|..|:|.|.|:.|.|..:|.....|..|:||.:.
  Fly   473 QVLHRLRYLSVQQNRKLTY-----LPATLFANTPNIRELLLAENGLLQLPTQISGLSRLQRLSVR 532

  Fly  1001 GNPITSLNNNSFDGVNEDLEMLDISNFR-LHYF-----EYGCLDSLPHLRSLKLTAYSHLEHFNI 1059
            ||.:.||..|             |...| |||.     ||.|..|:..|.:......:.|.| .:
  Fly   533 GNSLGSLPEN-------------IKELRQLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRH-QM 583

  Fly  1060 PHLLRH 1065
            |....|
  Fly   584 PQAQNH 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380
LRR_8 102..163 CDD:290566
leucine-rich repeat 104..128 CDD:275380
LRR_RI <128..261 CDD:238064
leucine-rich repeat 129..152 CDD:275380
LRR_8 152..212 CDD:290566
leucine-rich repeat 153..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR_8 202..261 CDD:290566
leucine-rich repeat 202..226 CDD:275380
leucine-rich repeat 227..250 CDD:275380
leucine-rich repeat 251..279 CDD:275380
leucine-rich repeat 280..326 CDD:275380
LRR_8 326..386 CDD:290566
leucine-rich repeat 327..348 CDD:275380
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
leucine-rich repeat 426..450 CDD:275378
LRR_RI <448..651 CDD:238064 37/209 (18%)
leucine-rich repeat 451..474 CDD:275380 156/656 (24%)
LRR_8 473..559 CDD:290566 20/93 (22%)
leucine-rich repeat 475..524 CDD:275380 10/55 (18%)
leucine-rich repeat 500..519 CDD:275380 3/18 (17%)
leucine-rich repeat 525..548 CDD:275380 7/24 (29%)
leucine-rich repeat 549..574 CDD:275380 3/24 (13%)
LRR_8 573..633 CDD:290566 10/67 (15%)
leucine-rich repeat 575..598 CDD:275380 4/27 (15%)
leucine-rich repeat 599..622 CDD:275380 5/25 (20%)
LRR_8 622..683 CDD:290566 13/76 (17%)
leucine-rich repeat 623..646 CDD:275380 4/22 (18%)
leucine-rich repeat 647..730 CDD:275380 17/101 (17%)
leucine-rich repeat 648..673 CDD:275380 5/40 (13%)
leucine-rich repeat 674..705 CDD:275380 4/30 (13%)
LRR_8 704..763 CDD:290566 17/61 (28%)
leucine-rich repeat 731..754 CDD:275380 6/22 (27%)
LRR_8 753..813 CDD:290566 19/59 (32%)
leucine-rich repeat 755..778 CDD:275380 9/22 (41%)
leucine-rich repeat 779..802 CDD:275380 6/22 (27%)
leucine-rich repeat 803..823 CDD:275380 9/20 (45%)
leucine-rich repeat 852..876 CDD:275380 7/23 (30%)
LRR_8 854..910 CDD:290566 19/58 (33%)
LRR_RI <877..>1006 CDD:238064 39/149 (26%)
leucine-rich repeat 877..900 CDD:275380 6/25 (24%)
leucine-rich repeat 901..925 CDD:275380 7/23 (30%)
leucine-rich repeat 926..946 CDD:275380 5/34 (15%)
LRR_8 947..1004 CDD:290566 19/59 (32%)
leucine-rich repeat 947..970 CDD:275380 6/25 (24%)
leucine-rich repeat 971..993 CDD:275380 7/21 (33%)
LRR_8 992..1049 CDD:290566 18/62 (29%)
leucine-rich repeat 994..1014 CDD:275380 8/19 (42%)
leucine-rich repeat 1019..1042 CDD:275380 9/28 (32%)
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 4/38 (11%)
leucine-rich repeat 229..252 CDD:275380 7/26 (27%)
LRR_RI <246..433 CDD:238064 61/197 (31%)
LRR_8 251..311 CDD:290566 17/63 (27%)
leucine-rich repeat 253..276 CDD:275380 6/22 (27%)
leucine-rich repeat 277..300 CDD:275380 9/22 (41%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
LRR_8 325..383 CDD:290566 23/59 (39%)
leucine-rich repeat 325..348 CDD:275380 10/22 (45%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
LRR_RI 351..>557 CDD:238064 63/230 (27%)
LRR_8 371..431 CDD:290566 21/66 (32%)
leucine-rich repeat 373..396 CDD:275380 10/28 (36%)
leucine-rich repeat 397..420 CDD:275380 5/22 (23%)
leucine-rich repeat 421..444 CDD:275380 7/23 (30%)
LRR_8 477..536 CDD:290566 22/63 (35%)
leucine-rich repeat 478..502 CDD:275380 8/28 (29%)
leucine-rich repeat 503..526 CDD:275380 7/22 (32%)
Ig <714..761 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.