DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mesh and zgc:112964

DIOPT Version :9

Sequence 1:NP_001163782.1 Gene:mesh / 43688 FlyBaseID:FBgn0051004 Length:1454 Species:Drosophila melanogaster
Sequence 2:NP_001314798.1 Gene:zgc:112964 / 503764 ZFINID:ZDB-GENE-050306-47 Length:300 Species:Danio rerio


Alignment Length:276 Identity:70/276 - (25%)
Similarity:99/276 - (35%) Gaps:84/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 MYWYFDKDMYGGRGD--YQFDIHASMTQLHKNLNFQLPFYGFRFNYTRLSLNGYLEFSDPPEYLT 228
            |::.|..:    .||  |..|.:.:.|.:  ||.....|:|..:|....::||||.|..|....|
Zfish    31 MFYSFGSE----AGDTVYTADGNENSTVI--NLESPFVFFGRTYNNIYANINGYLTFKQPSSDYT 89

  Fly   229 YPLVFPIKD--------WPAKRDPSFMGIF----FSKCRVGRIYPSDIDQRTPGVYFRVERDLMG 281
            :. .|||..        | ...|.|...|.    :|...|......||:...|.:.|        
Zfish    90 FQ-YFPINGSEDIIAPLW-TNADVSGNDIIAYQQYSSGDVLTRTTQDINHYFPNLSF-------- 144

  Fly   282 RTDRFGVEVRERTMWDIRQGVVGADTFIPKHVVIATWKNVSFAGGIDNSLYTTNT---FQMVLAT 343
                       |..|                |::.||..|.:.       |.:|.   ||:||.:
Zfish   145 -----------RATW----------------VLVVTWDQVDYT-------YQSNAASLFQVVLVS 175

  Fly   344 DEVYTYIIFNYAVLNWLSHTEAGGDTTKGEGGVPAYVGFNAGNGTQAYEYNPYSQN-MVIRDLAN 407
            ....::|:.||            ||....:..|.|  ||:..|.| ||...|.|.| .:|.:|.|
Zfish   176 GSDVSFILMNY------------GDCALTQNMVQA--GFDTINST-AYYVIPGSNNGTLIPNLMN 225

  Fly   408 RGWANGFPGRHIFRVD 423
            ....| .|||.:|||:
Zfish   226 SSNVN-VPGRWVFRVN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meshNP_001163782.1 NIDO 259..419 CDD:214712 39/163 (24%)
AMOP 660..805 CDD:281737
VWD 811..999 CDD:214566
CCP 1121..1171 CDD:214478
zgc:112964NP_001314798.1 NIDO 104..241 CDD:295411 48/196 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.