DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mesh and Ndg

DIOPT Version :9

Sequence 1:NP_001163782.1 Gene:mesh / 43688 FlyBaseID:FBgn0051004 Length:1454 Species:Drosophila melanogaster
Sequence 2:NP_610575.1 Gene:Ndg / 36089 FlyBaseID:FBgn0026403 Length:1350 Species:Drosophila melanogaster


Alignment Length:545 Identity:120/545 - (22%)
Similarity:200/545 - (36%) Gaps:150/545 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LAELRSNFMYWYFDKDMYGGRGDYQF----DIHASMTQLHKNLNFQLPFYGFRFNYTRLSLNGYL 218
            |..||::.:|.:.|    |..|....    |....:.||.:.::    |||.::....::.||.|
  Fly    28 LDSLRASELYEFED----GSLGSIHLLPKGDSETIVLQLEQPIH----FYGEQYEQLYINTNGIL 84

  Fly   219 EF-SDPPEYLTYPLVFPIKDWPAKRDPSFMGIFFSKCRVGRIYPSDIDQRTPGVYFRVERDLMGR 282
            .| |:.||||..|  ||:       :.:.:..|:|     .:..|..|:.|....|         
  Fly    85 TFNSEFPEYLNQP--FPL-------EYASIAAFYS-----NVDTSFSDEGTSISLF--------- 126

  Fly   283 TDRFGVEVRERTMWD-----IRQGVVGADTFIPKHVVIATWKNVSFAGGIDNSLYTTNTFQMVLA 342
                  |.:|:::.|     :|........|..:.|::|||:||   |..|:.....||||:.|.
  Fly   127 ------ESKEQSILDRASSLVRYAFSSQSEFEARQVIVATWRNV---GYFDSKTDRLNTFQVALI 182

  Fly   343 TDEVYTYIIFNY--AVLNWLSHTEAGGDTTKGEGGVPAYVGFNA---------GNGTQAYEYNPY 396
            .:|..|::.|.|  ..||||....||    .|...:.|..||.|         |:|::...:...
  Fly   183 ANEQSTFVQFIYPDGGLNWLQGETAG----LGLPDIRAQAGFVAEDGRFYTLNGSGSENARFLSE 243

  Fly   397 SQNMVIRDLANRGWANGFPGRHIFRV----DEQILIGSCNKDIDAALLPLTFAPESGNMLGGQVV 457
            |.|:            |.||..:|.|    :||.:....|.:      .||.:|    .|.....
  Fly   244 STNL------------GVPGVWLFEVAPIENEQNVRSPDNAE------SLTESP----ALALSCQ 286

  Fly   458 NITGPCFDPAIRVTCHFDTES---VLGTYVDRNRVICV---QPYLKAEGYIRFQISVGTQRFKWR 516
            .....|.:.|   .||...|.   |.|:....|...|:   || ::..|.:..:::......:.:
  Fly   287 AHAHQCHEKA---ECHDKAEGYCCVCGSGFYGNGKSCLANDQP-IRVTGTLTGELNKQPVSEEAK 347

  Fly   517 GKYFVETPAAATEKIFFTTDDVHKKNPAEIR--------ITW----------NQYNLTSNANANV 563
            .:.:|.|....|   :.|.:.:..:..|::|        :.|          |.|.||.....:|
  Fly   348 LQSYVVTSEGRT---YTTINPLTPELGAQLRLVLPLLTTVPWLFAKSVGGVANGYQLTGGVYTHV 409

  Fly   564 M------------------ISLWGYRETKIEPQLEYIDVIEASYSNSGSYVITPSNYINRNNINR 610
            .                  ::.|.....|||...| :..:.|.     :.:|.| :|:......|
  Fly   410 SRLQFDSGENLHVNQTFEGLNYWDQLSVKIEIYGE-VPAVAAD-----AVLILP-DYVEEYTFER 467

  Fly   611 DMQFGFLQ---INLTQPDQYSGLAI 632
            ..:...:|   ||:|:..:..||.:
  Fly   468 PGELKSVQVLNINITEEQRVLGLQV 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meshNP_001163782.1 NIDO 259..419 CDD:214712 44/175 (25%)
AMOP 660..805 CDD:281737
VWD 811..999 CDD:214566
CCP 1121..1171 CDD:214478
NdgNP_610575.1 NIDO 108..262 CDD:214712 48/192 (25%)
EGF_3 285..320 CDD:372403 8/37 (22%)
G2F 322..549 CDD:214774 31/182 (17%)
EGF_CA 591..627 CDD:311536
EGF_3 797..828 CDD:372403
EGF_3 836..873 CDD:372403
EGF_3 963..995 CDD:372403
EGF_3 1001..1036 CDD:372403
NHL 1059..>1275 CDD:302697
NHL repeat 1067..1103 CDD:271320
Ldl_recept_b 1084..1123 CDD:393440
LY 1107..1145 CDD:214531
NHL repeat 1117..1154 CDD:271320
LY 1152..1195 CDD:214531
NHL repeat 1161..1198 CDD:271320
NHL repeat 1204..1245 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.