DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mesh and dex-1

DIOPT Version :9

Sequence 1:NP_001163782.1 Gene:mesh / 43688 FlyBaseID:FBgn0051004 Length:1454 Species:Drosophila melanogaster
Sequence 2:NP_498182.2 Gene:dex-1 / 175761 WormBaseID:WBGene00017028 Length:1137 Species:Caenorhabditis elegans


Alignment Length:342 Identity:70/342 - (20%)
Similarity:117/342 - (34%) Gaps:105/342 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 NDYLGELY----DVDNSGYNWDPNNNVAPPTTYSTAAGGYTITAARLAELRSNFMYWYFDKDMYG 176
            |.|.|:.|    |||..    ..|:.:.......|...|               .|:...|:.:.
 Worm   397 NGYKGDGYNNCEDVDEC----KTNSTICHKNAICTNTPG---------------RYFCMCKEGFS 442

  Fly   177 GRGD--------YQFDIHASM-----TQLHKNLNFQLPFYGFRFNYTRLSLNGYLEFSDPPEYLT 228
            |.|.        :|:|.|..:     :::..||...|..:|.......::..|.:..::..    
 Worm   443 GDGQNDCSQSFLFQYDTHHQLPRKKNSKMEWNLKKPLKIFGETTEKLTVTSTGLIAINEVN---- 503

  Fly   229 YPLVFPIKDWPAKRDPSFMGI--FFSK---CRVGRIYPSDIDQRTPGVYFRVERDLMGRTDRFGV 288
                   :|.....|...:||  ||..   .|.|.:...::|.                     |
 Worm   504 -------RDNGRLEDMQLVGIAPFFGPIDLSRNGAVSVEEVDD---------------------V 540

  Fly   289 EVRERTMWDIRQGVVGADTFIPKHVVIATWKNVSFAGGIDNSLYTTNTFQMVL-----ATDEVYT 348
            ||..|....|.:. ....||:.|..::.|:.||:     |......||||.:|     :.:|..|
 Worm   541 EVLRRVTRTIGEN-YNDPTFVAKSALVVTFSNVT-----DGRQTKGNTFQALLIDGSNSKNEKMT 599

  Fly   349 YIIFNYAVLNWLSHTEAGGDTTKGEGGV--PAYVGFNAGNGTQAYEYNPYSQNMVIRDLANRGWA 411
            ::...|..|.|.|..|||..::.....:  ||       :||:|  .:..|:|..|:.       
 Worm   600 FVELMYRDLPWASGAEAGILSSDASSSILLPA-------SGTEA--ISQLSKNSNIKQ------- 648

  Fly   412 NGFPGRHIFRVDEQILI 428
               ||..::|:|:..|:
 Worm   649 ---PGTWLYRIDKAQLM 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meshNP_001163782.1 NIDO 259..419 CDD:214712 37/166 (22%)
AMOP 660..805 CDD:281737
VWD 811..999 CDD:214566
CCP 1121..1171 CDD:214478
dex-1NP_498182.2 NIDO 163..304 CDD:214712
EGF_3 413..445 CDD:403986 6/50 (12%)
NIDO 519..661 CDD:214712 43/187 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.