DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mesh and Adgrl4

DIOPT Version :9

Sequence 1:NP_001163782.1 Gene:mesh / 43688 FlyBaseID:FBgn0051004 Length:1454 Species:Drosophila melanogaster
Sequence 2:NP_573485.2 Gene:Adgrl4 / 170757 MGIID:2655562 Length:739 Species:Mus musculus


Alignment Length:199 Identity:46/199 - (23%)
Similarity:70/199 - (35%) Gaps:52/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ANENISTEEFEDQIINAVPEP--------------VKVTKPKAQAEFVEVPKATPAPKKAEADNP 71
            |:.|.:..||.:.|.|.|...              :.:||....||.|.:..|....|.::.|..
Mouse   234 AHFNSTLTEFGETINNFVERSTHKMWDQLPTNHRRLHLTKLMHTAELVTLQIAQNTQKNSQFDMN 298

  Fly    72 KTKPLALQ----KPTLIPVVH-----------VSSR-----GTDDILTVAGLKPEKMFGALIMPN 116
            .| .|||:    ..|.:...|           :|.|     ||...:.||.| ..|..|.|:..:
Mouse   299 ST-DLALKVFAFDSTHMKHAHPHMNVDGGYVKISPRRKAAHGTTGNVVVAFL-CYKSIGPLLSSS 361

  Fly   117 DYLGELYDVDNSGYNWDPNNNVA-----------PPTTYSTAAGGYTITAARLAEL-RSNFMYWY 169
            |..  |.|..|.  |.:....|.           |||.|......:|::..:|::. |:...:|.
Mouse   362 DNF--LLDTQND--NSEGKEKVISSVISASISSNPPTLYELEKITFTLSHVKLSDKHRTQCAFWN 422

  Fly   170 FDKD 173
            :..|
Mouse   423 YSVD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meshNP_001163782.1 NIDO 259..419 CDD:214712
AMOP 660..805 CDD:281737
VWD 811..999 CDD:214566
CCP 1121..1171 CDD:214478
Adgrl4NP_573485.2 EGF_CA 58..91 CDD:214542
EGF_CA 108..141 CDD:214542
GAIN 190..370 CDD:293098 34/139 (24%)
GPS 417..461 CDD:280071 2/10 (20%)
7tm_4 473..709 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.