DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mesh and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001163782.1 Gene:mesh / 43688 FlyBaseID:FBgn0051004 Length:1454 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:274 Identity:60/274 - (21%)
Similarity:105/274 - (38%) Gaps:81/274 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 FYGFRFNYTRLSLNGYLEFSDP---------PEYLTYPLVFPIKDWPAKRDPSFMGIFFSKCRVG 257
            ::|..::...::.||.|.|..|         |.|.|..::.|:  |                   
Zfish   100 YFGNTYDTIFVNNNGDLTFDKPLHQYNPDNFPAYSTRDIIAPL--W------------------- 143

  Fly   258 RIYPSDIDQRTPGV--YFRVER-DLMGRTDRFGVEVRERTMWDIRQGVVGADTFIPKHVVIATWK 319
                :||:....|.  |.:|.. |::.|..:           ||.:.....: |....|.||||.
Zfish   144 ----TDINNGMEGTISYRQVTNGDILNRASK-----------DINRYFPNLN-FSASWVFIATWD 192

  Fly   320 NVSFAGGIDNSLYTTNTFQMVLATDEVYTYIIFNYAVLNWLSHTEAGGDTTKGEGGVPAYVGFNA 384
            .|.:.|..::.    :|||:||.:|:..::.:.:|..:.:....|:|.||    .|...:.....
Zfish   193 KVPYYGYRESE----STFQVVLVSDKKRSFTLMHYDYITYTQSAESGYDT----NGSTVFYSIPV 249

  Fly   385 GNGTQAYEYNPYSQNMVIRDLANRGWANGFPGRHIFRVDEQILI-GSC----NKDID---AALLP 441
            .:.|..    ||:.|:.::            ||.:||||....: |||    ::.:|   ||:..
Zfish   250 SDVTNL----PYTSNVNVK------------GRWVFRVDNSSEVKGSCINTNSQALDSPSAAVCG 298

  Fly   442 LTFAPESGNMLGGQ 455
            :.....|...:|||
Zfish   299 IIPVNSSNGTVGGQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meshNP_001163782.1 NIDO 259..419 CDD:214712 35/162 (22%)
AMOP 660..805 CDD:281737
VWD 811..999 CDD:214566
CCP 1121..1171 CDD:214478
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 39/191 (20%)
Tryp_SPc 309..537 CDD:238113 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.