DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stops and Asb17

DIOPT Version :9

Sequence 1:NP_733416.2 Gene:stops / 43683 FlyBaseID:FBgn0086704 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001103146.1 Gene:Asb17 / 687364 RGDID:1586533 Length:295 Species:Rattus norvegicus


Alignment Length:306 Identity:66/306 - (21%)
Similarity:115/306 - (37%) Gaps:100/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 TDEVAAIAVTAAMRYHRMAKEQN---GQVCLMGKYHNILYIGLRTCWDWGVRDSEVVVKLLVAIY 186
            ||.:|.:..:.    ||.....|   .::|:    :.|||      |.:..:.:...|:||:   
  Rat    68 TDYIAFVEKSG----HRFELNFNLEFTEICV----NTILY------WVFARKGNPDFVELLL--- 115

  Fly   187 ECEKTYERIFLGALFGPHAPHFIAGWRSDFQDQHENVRAMVYFLKHATREQLTLPVWIPRFEQER 251
              :||.:.:                     ||:..:: |:::        :...||:.|.     
  Rat   116 --KKTKDYV---------------------QDRSCSL-ALIW--------RTFTPVYCPS----- 143

  Fly   252 QLRFIDVPIESCGKSSPLRIALQANAPELLLILLRYGAAPQPPDGGASVIIALL----------D 306
                   |:...   :||....|.....:|.|||:||...:..:....|:..||          .
  Rat   144 -------PLSGI---TPLLYVAQTRQSNILKILLQYGILEREKNPINIVLTILLYPSRVRIMVDH 198

  Fly   307 KLIEDGRNYSFELVMCLKILLRNVVMIEMPFKPLLYAARREMFFDRYGRLLMDKIIGKEQVYGVP 371
            :||:...:....|.:|.::|  :|:.:. ..:..|...||             .||.....|..|
  Rat   199 ELIDIQEDAKTCLTLCSRVL--SVISVR-EIETQLNLGRR-------------PIIQNWLDYIPP 247

  Fly   372 S-------LRHLCRCCIRDVMRMHNQLPSGIDTLRLPKRLQRYIDL 410
            :       |.||||..||..:..:|.||:||.:|.:|.|||.:::|
  Rat   248 TRYKDPCELVHLCRITIRTQLLANNMLPNGIFSLLIPTRLQNFLNL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stopsNP_733416.2 SOCS_box 370..408 CDD:284857 18/44 (41%)
Asb17NP_001103146.1 SOCS_ASB_like 251..294 CDD:239686 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR20966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.