DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stops and Asb17

DIOPT Version :9

Sequence 1:NP_733416.2 Gene:stops / 43683 FlyBaseID:FBgn0086704 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_080034.2 Gene:Asb17 / 66772 MGIID:1914022 Length:295 Species:Mus musculus


Alignment Length:309 Identity:64/309 - (20%)
Similarity:119/309 - (38%) Gaps:106/309 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 TDEVAAIAVTAAMRYHRMAKEQN---GQVCLMGKYHNILYIGLRTCWDWGVRDSEVVVKLLVAIY 186
            ||.:|.:..:.    ||.....|   .::|:    :.|||      |.:..:.:...|:||:   
Mouse    68 TDYIAFVEKSG----HRFELNFNLEFTEICV----NTILY------WVFARKGNPDFVELLL--- 115

  Fly   187 ECEKTYERIFLGALFGPHAPHFIAGWRSDFQDQHENVRAMVYFLKHATREQLTLPVWIPRFEQER 251
              :||.:.:                     ||:..:: |:::        :...||:.|.     
Mouse   116 --KKTKDYV---------------------QDRSCSL-ALIW--------RTFTPVYCPS----- 143

  Fly   252 QLRFIDVPIESCGKSSPLRIALQANAPELLLILLRYGAAPQPPDGGASVIIALL----------D 306
                   |:...   :||....|.....:|.|||:||...:..:....|:..||          .
Mouse   144 -------PLSGI---TPLLYVAQTRQSNILKILLQYGILEREKNPINIVLTILLYPSRVRIMVDH 198

  Fly   307 KLIEDGRNYSFELVMCLKIL----LRNV-VMIEMPFKPLLYAARREMFFD-----RYGRLLMDKI 361
            :||:...:....|::|.::|    :|.: ..:.:..:|::     :.:.|     ||        
Mouse   199 ELIDIQEDAKTCLMLCSRVLSTISVREIETQLSLGRRPII-----QNWLDYIPPTRY-------- 250

  Fly   362 IGKEQVYGVPSLRHLCRCCIRDVMRMHNQLPSGIDTLRLPKRLQRYIDL 410
              |:..    .|.||||..||..:..:|.||:||.:|.:|.|||.:::|
Mouse   251 --KDPC----ELVHLCRITIRTQLLANNMLPNGIFSLLIPTRLQNFLNL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stopsNP_733416.2 SOCS_box 370..408 CDD:284857 17/37 (46%)
Asb17NP_080034.2 ANK 95..216 CDD:295348 32/176 (18%)
Ank_2 103..171 CDD:289560 20/117 (17%)
ANK 146..176 9/32 (28%)
SOCS_ASB_like 251..294 CDD:239686 19/47 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR20966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.990

Return to query results.
Submit another query.