DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stops and ASB17

DIOPT Version :9

Sequence 1:NP_733416.2 Gene:stops / 43683 FlyBaseID:FBgn0086704 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_543144.1 Gene:ASB17 / 127247 HGNCID:19769 Length:295 Species:Homo sapiens


Alignment Length:286 Identity:61/286 - (21%)
Similarity:112/286 - (39%) Gaps:107/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 QVCLMGKYHNILYIGLRTCWDWGVRDSEVVVKLLVAIYECEKTYERIFLGALFGPHAPHFIAGWR 213
            ::|:    :.|||      |.:..:.:...|:||:     :||.:.:                  
Human    91 EICV----NTILY------WVFARKGNPDFVELLL-----KKTKDYV------------------ 122

  Fly   214 SDFQDQHENVRAMVYFLKHATREQLTLPVWIPRFEQERQLRFIDVPIESCGKSSPLRIALQANAP 278
               ||:..|: |:::        :...||:.|.            |:...   :||....|....
Human   123 ---QDRSCNL-ALIW--------RTFTPVYCPS------------PLSGI---TPLFYVAQTRQS 160

  Fly   279 ELLLILLRYGAAPQ---PPDGGASVII------ALLDK----LIEDGRNYSFELVMCLKILLRNV 330
            .:..|||:||...:   |.:...::::      .::|:    :.||.:..   ||:|.::|  :|
Human   161 NIFKILLQYGILEREKNPINIVLTIVLYPSRVRVMVDRELADIHEDAKTC---LVLCSRVL--SV 220

  Fly   331 VMIEMPFKPLLYAARREM---FFDRYGRLLMDKIIGKEQVYGVPSLR--------HLCRCCIRDV 384
            :.:: ..|..|...|..:   :||.                 :||.|        ||||..||:.
Human   221 ISVK-EIKTQLSLGRHPIISNWFDY-----------------IPSTRYKDPCELLHLCRLTIRNQ 267

  Fly   385 MRMHNQLPSGIDTLRLPKRLQRYIDL 410
            :..:|.||.||.:|.:|.|||.|::|
Human   268 LLTNNMLPDGIFSLLIPARLQNYLNL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stopsNP_733416.2 SOCS_box 370..408 CDD:284857 19/45 (42%)
ASB17NP_543144.1 ANK 95..177 CDD:321973 25/137 (18%)
ANK 146..176 8/32 (25%)
SOCS_ASB_like 251..294 CDD:239686 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR20966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.