DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Gyc76C

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster


Alignment Length:381 Identity:123/381 - (32%)
Similarity:189/381 - (49%) Gaps:72/381 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LIEVVEAIRPHLQLNFE--NILSHINTIYVLQTRQGAMSSRHEQRFLRLKGQMMYIPETDRI--- 429
            :.|:.....|..|:|||  .|:.::                   :.|.|||:..:.||.:.|   
  Fly   744 MYEIFSRKGPFGQINFEPKEIVDYV-------------------KKLPLKGEDPFRPEVESIIEA 789

  Fly   430 ----------LFQCY-------PSVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTK 477
                      :..|:       |....:.:..||         ....:...::.:..|...|...
  Fly   790 ESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKK---------MRGGKTKNIMDQMMEMMEKYAN 845

  Fly   478 NLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVGFGQ 542
            |||   |.:.:..|.|..||.||:.||:.:||:|||.:|...:.|.|..||.||:.||.||||..
  Fly   846 NLE---DIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTA 907

  Fly   543 YCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLP-DHCEDHAKCM 606
            ..|.:|    .:::|..||:||||||.:.   |..:||||||:||.||.||||| .:.:.||..:
  Fly   908 MSAEST----PLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEI 965

  Fly   607 ARVALDMMDMAKNVKMGSNP---VQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGV 668
            |.:||:::...|..::...|   :::.||:|:|.||.||:|..:|||||||:|||..||.|:.|.
  Fly   966 ASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGE 1030

  Fly   669 PGRINVSEETYRLLC-MAINQ-DDSFHLEYRGPVIMKGKPTPMDCWFLTRATSSIL 722
            ..:|::|.:     | :|::: ...:..|.||.|.||||...: .|:||.|..:.:
  Fly  1031 ALKIHISNK-----CKLALDKLGGGYITEKRGLVNMKGKGDVV-TWWLTGANENAI 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 37/167 (22%)
CYCc 496..688 CDD:214485 85/196 (43%)
Guanylate_cyc 522..714 CDD:278633 82/197 (42%)
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 18/110 (16%)
HNOBA <835..881 CDD:285003 19/48 (40%)
CYCc 860..1052 CDD:214485 85/203 (42%)
Guanylate_cyc 887..1074 CDD:278633 83/199 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.