DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Adcy7

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:267 Identity:84/267 - (31%)
Similarity:136/267 - (50%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 LHDAARDLVLLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANEL--- 516
            |.||:|||.:                 .|.|..|..|.|..||::.:.||.||||..::..:   
  Rat   203 LQDASRDLFI-----------------YTVKCIQIRRKLRVEKRQQENLLLSVLPAHISMGMKLA 250

  Fly   517 ----------RHQRP------VPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYT 565
                      ||..|      :..||:.:|:::::.||||.: .|::..|   .::|.:||||:.
  Rat   251 IIERLKEGGDRHYTPDNNFHSLYVKRHQNVSILYADIVGFTR-LASDCSP---KELVVVLNELFG 311

  Fly   566 VFDALTDSKRNLNVYKVETVGDKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNVKMGSN-PVQI 629
            .||.:  :|.| ...:::.:||.|..|||||.....||:...::.||:.:..|.|:..:. .:.:
  Rat   312 KFDQI--AKAN-ECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAIKQVREATGVDISM 373

  Fly   630 TIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHL 694
            .:|||||.|:.||||.|..:|.::.:.|:|.:|.|..|||||::::|.|...|..|...:|. |.
  Rat   374 RVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEATLNHLDKAYEVEDG-HG 437

  Fly   695 EYRGPVI 701
            |.|.|.:
  Rat   438 EQRDPYL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 19/60 (32%)
CYCc 496..688 CDD:214485 68/211 (32%)
Guanylate_cyc 522..714 CDD:278633 62/181 (34%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454 19/64 (30%)
Guanylate_cyc 272..422 CDD:306677 54/156 (35%)
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.