DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Adcy2

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_112269.2 Gene:Adcy2 / 81636 RGDID:619965 Length:1095 Species:Rattus norvegicus


Alignment Length:248 Identity:81/248 - (32%)
Similarity:131/248 - (52%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LQQTFRD----------LESEKQKTDRLLYSVLPKSVANELRH---QRPVPP------------- 524
            ||||:||          ||.||::.:|||.|:||..:|.|::.   ||...|             
  Rat   220 LQQTYRDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHN 284

  Fly   525 ---KRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVG 586
               ||:.:|:::::.||||.: .|::..|.   ::|.|||||:..||.:  :|.| ...:::.:|
  Rat   285 LYVKRHTNVSILYADIVGFTR-LASDCSPG---ELVHMLNELFGKFDQI--AKEN-ECMRIKILG 342

  Fly   587 DKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNVKMGSN-PVQITIGIHSGEVVTGVIGNRVPRY 650
            |.|..|||||....:|||...::.|||.:..|.|:..:. .:.:.:|:|||.|:.||||.:..:|
  Rat   343 DCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQY 407

  Fly   651 CLFGNTVNLTSRTETTGVPGRINVSEETYRLL--CMAINQDDSFHLEYRGPVI 701
            .::.:.|.|.:..|..|||||:::|..|...|  ...:.:.|.   |.|.|.:
  Rat   408 DVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDG---EIRDPYL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 17/39 (44%)
CYCc 496..688 CDD:214485 69/213 (32%)
Guanylate_cyc 522..714 CDD:278633 61/199 (31%)
Adcy2NP_112269.2 AC_N <37..264 CDD:318454 18/43 (42%)
Guanylate_cyc 285..469 CDD:306677 60/183 (33%)
DUF1053 499..603 CDD:399378
Guanylate_cyc 882..1081 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.