DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Gucy2g

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:243 Identity:94/243 - (38%)
Similarity:151/243 - (62%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 KLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIV 538
            ||......|.:.:::..|:|.:||:|.::||.::||..|..:|...:.|.|:.::|||:.||.||
Mouse   844 KLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIV 908

  Fly   539 GFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLP-DHCEDH 602
            ||.:.|:.::    .:::||:||:||::||....|.   :||||||:||.||..|||| .:...|
Mouse   909 GFTKLCSLSS----PLQVVKLLNDLYSLFDHTIQSH---DVYKVETIGDAYMVASGLPIRNGAQH 966

  Fly   603 AKCMARVALDMMDMAKNVKMGSNP---VQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTE 664
            |..:|.:||.::.:..:.::|..|   :::.||:|:|.||.||:|..:|||||||:|||:.||.|
Mouse   967 ADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRME 1031

  Fly   665 TTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCW 712
            ::.:|.||:||:.|...|..|    ..:||:.||.:.:|||......|
Mouse  1032 SSSLPLRIHVSQSTAGALLAA----GGYHLQKRGTISVKGKGEQTTFW 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 13/41 (32%)
CYCc 496..688 CDD:214485 81/195 (42%)
Guanylate_cyc 522..714 CDD:278633 80/195 (41%)
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894
CYCc 865..1055 CDD:214485 81/200 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.