DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and CG34357

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster


Alignment Length:378 Identity:129/378 - (34%)
Similarity:193/378 - (51%) Gaps:68/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 PETDRILFQCY-------PSVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTKNLEM 481
            ||...|:.||:       |...::.:..|         :.:..|.:..:...|:...|.:.|||.
  Fly  1008 PEAINIMRQCWAEQPDMRPDFNSVYERFK---------MLNHGRKVNFVDTMFQMLEKYSNNLEE 1063

  Fly   482 LTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVGFGQYCAA 546
            |   :::....|:.|::||::||..:||.|||.:|:....|.|:.:..||:.||.|||| ...||
  Fly  1064 L---IRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGF-TTIAA 1124

  Fly   547 NTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLPDHCEDHAKCMARVAL 611
            :..|   :::|.:||:|||:|||..::   .|||||||:||.||.|||||....|||:.:|.:||
  Fly  1125 HCSP---VQVVDLLNDLYTIFDATINA---YNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMAL 1183

  Fly   612 DMMDMAK--NVK-MGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRIN 673
            |::..:.  ||| :...|:|:.||:|:|....||:|..:|||||||:|||..||.|:||...||:
  Fly  1184 DLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIH 1248

  Fly   674 VSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTRATSSILGGTSSTGGSGGGGNGS 738
            :|:||...|    :....:.:|.||.:.:|||......|.|                    |...
  Fly  1249 MSQETRDRL----DARGGYAIEPRGLIDIKGKGMMNTFWLL--------------------GKKG 1289

  Fly   739 LDSPLLQPATPTAGAA---------TPIPVVAQ----RAAGHASVSRTSSAGG 778
            .|.||  ||.|..|.:         ..|.:.||    |.:.:.|.|::||..|
  Fly  1290 FDKPL--PAPPPIGESHGLDESLIRNSITLKAQANKSRTSTNPSSSQSSSLAG 1340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 25/98 (26%)
CYCc 496..688 CDD:214485 89/194 (46%)
Guanylate_cyc 522..714 CDD:278633 85/194 (44%)
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 7/41 (17%)
CYCc 1074..1266 CDD:214485 89/202 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.