DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and adcy1b

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001161822.1 Gene:adcy1b / 569499 ZFINID:ZDB-GENE-100805-1 Length:1114 Species:Danio rerio


Alignment Length:358 Identity:100/358 - (27%)
Similarity:159/358 - (44%) Gaps:55/358 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 SVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTKNLEMLTDKLQQTFRD-LESEKQK 499
            ||..|:.|....|:.:.|.||....||.|             .|:.|.....:..|| :|..|..
Zfish   761 SVRGLEPLLSLLLFSTAVALHSRQLDLKL-------------RLDFLWATQAEEERDGMEKVKLD 812

  Fly   500 TDRLLYSVLPKSVANELRHQRP----VPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKML 560
            ..|:|:::||..||.......|    :..:.|..|.::|:.|..|..:.......:..::.:::|
Zfish   813 NKRILFNLLPVHVAQHFLLSNPRNMDLYYQSYAQVGVLFASIPNFNDFYIELDGNNMGVECLRLL 877

  Fly   561 NELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGL--------PDHCEDHAKCMARVALDMMDMA 617
            ||:...||.|.|.:...::.|::|:|..||:..||        ......|...:|..|::|.|:.
Zfish   878 NEIIADFDELMDKECYKDIEKIKTIGSTYMSAVGLVPTIGTKAKKSTATHLSTIADFAIEMFDVL 942

  Fly   618 KNVKMGS-NPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRL 681
            ..:...| |...:.:||:.|.||.||||.|.|:|.::|||||:.||.::|||||:|.|:|:.|||
Zfish   943 DEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVPGKIQVTEDVYRL 1007

  Fly   682 LCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTRATSSILGGTSSTGGSGGGGNGSLDSPLLQP 746
            |      .:::.|..||.|.:||| ..|..:||                     .|....|.::.
Zfish  1008 L------QNNYDLMCRGNVSVKGK-GQMLTYFL---------------------EGKAQDPGIRA 1044

  Fly   747 ATPTAGAATPIPVVAQRAAGHASVSRTSSAGGG 779
            ...|.|....:..:|:.::........|||..|
Zfish  1045 PHHTGGLERRVHAIARTSSTQTKAGSVSSATSG 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 23/80 (29%)
CYCc 496..688 CDD:214485 65/204 (32%)
Guanylate_cyc 522..714 CDD:278633 65/200 (33%)
adcy1bNP_001161822.1 AC_N <128..270 CDD:292831
CYCc 236..431 CDD:214485
Guanylate_cyc 272..454 CDD:278633
DUF1053 498..585 CDD:283888
CYCc 806..1012 CDD:214485 66/211 (31%)
Guanylate_cyc 839..1035 CDD:278633 67/223 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.