DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and adcy2a

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_692173.5 Gene:adcy2a / 563724 ZFINID:ZDB-GENE-061109-1 Length:1155 Species:Danio rerio


Alignment Length:246 Identity:79/246 - (32%)
Similarity:133/246 - (54%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LQQTFRD----------LESEKQKTDRLLYSVLPKSVANELRH---QRPVPPK------------ 525
            |:||::|          ||.||::.:|||.|:||..:|..::.   ||...||            
Zfish   275 LKQTYQDTCNCIKSPIKLEFEKRQQERLLLSLLPAHIARVMKAEIIQRLQGPKFGQVENTNNFHN 339

  Fly   526 ----RYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVG 586
                |:.:|:::::.||||.: .|::..|.   ::|.|||||:..||.:  :|.| ...:::.:|
Zfish   340 LYVQRHTNVSILYADIVGFTR-LASDCSPG---ELVHMLNELFGKFDQI--AKEN-ECMRIKILG 397

  Fly   587 DKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNVKMGSN-PVQITIGIHSGEVVTGVIGNRVPRY 650
            |.|..|||||:...:|||...::.|||.:..|.|:..:. .:.:.:|:|||.|:.||||.:..:|
Zfish   398 DCYYCVSGLPESLPNHAKNCVKMGLDMCEAIKKVRDATGVEISMRVGVHSGNVLCGVIGLQKWQY 462

  Fly   651 CLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVI 701
            .::.:.|.|.:..|..|||||::::.||...|..|...:|. |.:.|.|.:
Zfish   463 DVWSHDVTLANHMEAGGVPGRVHITSETLEHLNGAYKVEDG-HGQERDPYL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 15/39 (38%)
CYCc 496..688 CDD:214485 69/211 (33%)
Guanylate_cyc 522..714 CDD:278633 62/197 (31%)
adcy2aXP_692173.5 AC_N <92..319 CDD:292831 15/43 (35%)
CYCc 295..498 CDD:214485 68/209 (33%)
Guanylate_cyc 340..524 CDD:278633 60/181 (33%)
DUF1053 554..658 CDD:283888
CYCc 912..1120 CDD:214485
Guanylate_cyc 942..1141 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.