DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Adcy4

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_062158.2 Gene:Adcy4 / 54223 RGDID:2034 Length:1072 Species:Rattus norvegicus


Alignment Length:404 Identity:106/404 - (26%)
Similarity:179/404 - (44%) Gaps:94/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 VMNLDDLTKKGLYISDVPLHDAARDLV----------LLSEKFEAEYKLTKNLEMLTDKLQQTFR 491
            :.:|..|...|||:...|  ::.|||:          |......|.:|     .::...|:.|||
  Rat   147 ISSLSHLLVLGLYLGWRP--ESQRDLLPQLAANAVLFLCGNVVGAYHK-----ALMERALRATFR 204

  Fly   492 D----------LESEKQKTDRLLYSVLPKSVANELRHQ-----------RP--------VPPKRY 527
            :          |::||:..:.||.|:||..:|.|::.:           ||        :..||:
  Rat   205 EALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQSSRPENTNNFHSLYVKRH 269

  Fly   528 DSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAV 592
            ..|:::::.||||.: .|:...|   .::|.|||||:..||.:.   :.....:::.:||.|..|
  Rat   270 QGVSVLYADIVGFTR-LASECSP---KELVLMLNELFGKFDQIA---KEHECMRIKILGDCYYCV 327

  Fly   593 SGLPDHCEDHAKCMARVALDMMDMAKNVKMGSN-PVQITIGIHSGEVVTGVIGNRVPRYCLFGNT 656
            ||||....|||....|:.|||....:.:::.:. .:.:.:|:|||.|:.||||.:..:|.::.:.
  Rat   328 SGLPLSLPDHAINCVRMGLDMCRAIRKLRVATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHD 392

  Fly   657 VNLTSRTETTGVPGRINVSEETYRLL--CMAINQDDSFHLEYRGPVIMK-GKPT--PMDCWFLTR 716
            |.|.:..|..|||||::::..|..||  ..|:.:.|   :|:|.|.:.: |:||  .:|.|    
  Rat   393 VTLANHMEAGGVPGRVHITGATLALLAGAYAVERAD---MEHRDPYLRELGEPTYLVIDPW---- 450

  Fly   717 ATSSILGGTSSTGGSGGGGNGSLDSPLLQP-------------ATP---------TAGAATPIPV 759
                  .......|:..|...||:...::|             |.|         .|..:||:|.
  Rat   451 ------AEEEDEKGTERGLLSSLEGHTMRPSLLMTRYLESWGAAKPFAHLSHVDSPASTSTPLPE 509

  Fly   760 VAQRAAGHASVSRT 773
            .|.........|||
  Rat   510 KAFSPQWSLDRSRT 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 25/98 (26%)
CYCc 496..688 CDD:214485 65/213 (31%)
Guanylate_cyc 522..714 CDD:278633 63/197 (32%)
Adcy4NP_062158.2 AC_N <115..246 CDD:292831 26/105 (25%)
CYCc 219..422 CDD:214485 64/209 (31%)
Guanylate_cyc 264..430 CDD:278633 55/175 (31%)
DUF1053 479..580 CDD:283888 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..523 6/24 (25%)
CYCc 824..1039 CDD:214485
Guanylate_cyc 861..1060 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.