DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Ac76E

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:369 Identity:88/369 - (23%)
Similarity:152/369 - (41%) Gaps:107/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 YIPETDRILFQCYPSVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTKNLEMLTDKL 486
            |.|.    |...:..::.|...:..|||..  .:.|||.:..:...:...|.::           
  Fly   207 YAPN----LPMLFGEIVMLASASVSGLYYR--IMSDAAHNRTVDGTRTGIEQRV----------- 254

  Fly   487 QQTFRDLESEKQKTDRLLYSVLPKSVANELR-------------------------HQRPVPPKR 526
                 .||.|:::.::||.||:|..:|.|::                         |:..|  :|
  Fly   255 -----KLECEREQQEQLLLSVIPAYIAAEVKRSIMLKMADACQRAGGQASTSATRFHELHV--QR 312

  Fly   527 YDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMA 591
            :.:||::|:.||.|....::.|..|    :||.||:|:..||.:....:.|   :::.:||.|..
  Fly   313 HTNVTILFADIVNFTPLSSSLTASD----LVKTLNDLFGRFDQIAQENQCL---RIKILGDCYYC 370

  Fly   592 VSGLPDHCEDHAKCMARVALDMMDMAKNVK--MGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFG 654
            |||||.....||.....:.|.|:|..::|:  .|.| |.:.||||:|.|:.||:|.|..::.::.
  Fly   371 VSGLPISRPQHATNCVNMGLQMIDAIRHVREATGIN-VDMRIGIHTGNVLCGVLGLRKWQFDVWS 434

  Fly   655 NTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTRATS 719
            :.|.|.:..|:.||.||::::::|...|      .|.|.:|                        
  Fly   435 DDVTLANHMESGGVAGRVHITKQTLDFL------GDKFEVE------------------------ 469

  Fly   720 SILGGTSSTGGSGGGGN-------GSLDSPLLQPATPTAGAATP 756
                       .|.|||       ..::|.|:.|..|....:.|
  Fly   470 -----------QGEGGNRDAYLADHKVESYLIVPPKPAYTYSVP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 20/93 (22%)
CYCc 496..688 CDD:214485 63/218 (29%)
Guanylate_cyc 522..714 CDD:278633 57/193 (30%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 21/103 (20%)
CYCc 259..467 CDD:214485 64/223 (29%)
Guanylate_cyc 311..469 CDD:278633 55/171 (32%)
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.