DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and CG10738

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:349 Identity:120/349 - (34%)
Similarity:175/349 - (50%) Gaps:61/349 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 PLHDAAR-----DLVLLSEKFEAEYKLTKNLEML----TDKLQQTFRDLESEKQKTDRLLYSVLP 509
            ||....|     :::.:.||:      ..|||.|    ||:||:       ||:|||.||:.:||
  Fly   849 PLRKGMRPNIFDNMMAMMEKY------ANNLEALVDDRTDQLQE-------EKKKTDALLHEMLP 900

  Fly   510 KSVANELRHQRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSK 574
            :.||::|:....|.|:.|:.|::.||.||||....|..|    .:::|..||:|||.||::..  
  Fly   901 RCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECT----PLQVVDFLNDLYTCFDSIIG-- 959

  Fly   575 RNLNVYKVETVGDKYMAVSGLPDHCED-HAKCMARVALDMMDMAKNVKMGSNPVQ---ITIGIHS 635
             :.:||||||:||.||.|||||....| ||..:|.::|.::......|:...|..   :.|||||
  Fly   960 -HYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHS 1023

  Fly   636 GEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPV 700
            |.|..||:|.::|||||||:|||..||.|::|||.:|:.|.:..:||    ::...:|...||.:
  Fly  1024 GPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLL----DRLGGYHFAERGVI 1084

  Fly   701 IMKGKPTPMDCWFL-------------------TRATSSILGGTSSTGGSGGGGNGSLDSPLLQP 746
            .||||......|.|                   :||.:..:.||...........| :.|.|.|.
  Fly  1085 SMKGKGDQRTYWLLGEDEEARTRRTYERSQRRGSRALNKFIQGTIKQAQEQANEYG-IRSSLKQK 1148

  Fly   747 ATP----TAGAATPIPVVAQRAAG 766
            ..|    |..::...|...:.|||
  Fly  1149 NLPRNSLTRSSSLESPKKLRFAAG 1172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 24/70 (34%)
CYCc 496..688 CDD:214485 84/195 (43%)
Guanylate_cyc 522..714 CDD:278633 80/195 (41%)
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 2/3 (67%)
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 21/57 (37%)
CYCc 886..1078 CDD:214485 84/209 (40%)
Guanylate_cyc 913..1099 CDD:278633 80/196 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.