DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and CG32301

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster


Alignment Length:433 Identity:89/433 - (20%)
Similarity:175/433 - (40%) Gaps:119/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 LLKNKSDDIERYDHVQFLIREINVAAKSQVDAKKDEVPDDMEFLCEAPLISPATFCKVFPFHLMF 343
            |:.::..::|:|:.:..|:..:.....:.:|                 ||.|  .|...||.|  
  Fly    95 LMPSREPNVEQYESIAILVSCLMALLLTAMD-----------------LILP--ICYFRPFSL-- 138

  Fly   344 DRQMKIVQAGKAVSRVIPRVAEENCSLIEVVEAIRPHLQLNFENILSHINTIYVLQTRQGAMSSR 408
                            :|                      ::::::  |..||::.......:.|
  Fly   139 ----------------VP----------------------SYDHVV--IVLIYLMFPIAFVKNGR 163

  Fly   409 HEQRFLRLKGQMMYIPETDRILFQCYPSVMNLD---DLTKKGLYISDVPLHDAARDLVLLSEKFE 470
              ..||.|...:.|......|     ..:..||   :||..|.|:..:.:      |.:...:|:
  Fly   164 --AYFLGLAVSLFYFGYMALI-----DKISTLDKVWELTAYGAYLFFLNM------LCMFLSRFQ 215

  Fly   471 AEYKLTKNLEMLTDKLQQTFRDL--ESEKQKTDRLLYSVLPKSVANEL----------------- 516
             ||.:...   :..:.|..:::|  :...::...||.|::|.::|..|                 
  Fly   216 -EYNMRSG---ILSRYQVVYQNLVFQMAMKEEKALLDSIIPVTLARSLQDAIASHIEEDPSNLMP 276

  Fly   517 ----RH--QRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKR 575
                ||  ..|.|     .|:::.:.:|.|    ...|.......:|.:|:||:..||...:..|
  Fly   277 FTKTRHLFMEPHP-----EVSILEADMVDF----TGLTTTMEVSDLVAILHELFVSFDLAANHNR 332

  Fly   576 NLNVYKVETVGDKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNV-KMGSNPVQITIGIHSGEVV 639
               ..:::.:||.|..|:|:|.:...||......||||:::::.| |..:..:.:.||:||||::
  Fly   333 ---ATRIKFLGDSYTCVTGIPSYFPTHANACVNQALDMIEISREVSKRRNKKIDLRIGVHSGEIL 394

  Fly   640 TGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLL 682
            .|:||....::.::...|::|:|.|::|:||.:::|..|..||
  Fly   395 AGIIGLTKWQFDIWSKDVDITNRLESSGLPGMVHISSRTLGLL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 34/194 (18%)
CYCc 496..688 CDD:214485 55/211 (26%)
Guanylate_cyc 522..714 CDD:278633 46/162 (28%)
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 47/167 (28%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.