DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and ACXC

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster


Alignment Length:306 Identity:82/306 - (26%)
Similarity:135/306 - (44%) Gaps:82/306 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 LVLLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVA----NEL-RHQRP 521
            |.:.:::.::|:....|.::..| ||...:..:...|....||.::||..|.    |.| :|:  
  Fly   799 LTMYAKERQSEFNTKMNYKLNVD-LQNKQKAADLTNQSIIILLNNILPSHVVDLYLNSLAKHE-- 860

  Fly   522 VPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVY-KVETV 585
            :..:.|..|::||:.::.|..          .:..:::||::.|.||.|..:.|...|. |::.|
  Fly   861 LYYENYRMVSVMFAMLINFPM----------NLPSLRVLNDIITQFDRLLTAYREYYVVEKIKVV 915

  Fly   586 GDKYMAVSGL----------PDHCE--------DHAK--------------------CMARVALD 612
            |..|||..||          .||..        :||:                    .|...|||
  Fly   916 GCTYMAACGLDFNLASNIRQTDHFRNSSLHVEVEHARNHRMTDENYDSDMNNDEVVFIMTTFALD 980

  Fly   613 MMD-------------MAKNVKMGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTE 664
            :|.             ..:::..|    :|.|||.|||::.||:|...|.|.::||.||:.||.|
  Fly   981 LMRTLAACNRAYSSSFFERSLSQG----KICIGISSGEIMAGVVGASQPHYDIWGNPVNMASRME 1041

  Fly   665 TTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGK---PT 707
            :||:||.|.|:||:.::|     |:......|||...:||:   ||
  Fly  1042 STGLPGHIQVTEESAKIL-----QEFDIKCIYRGMTFVKGRGDIPT 1082

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 13/57 (23%)
CYCc 496..688 CDD:214485 68/248 (27%)
Guanylate_cyc 522..714 CDD:278633 67/241 (28%)
ACXCNP_609593.1 AC_N <33..285 CDD:292831
CYCc 293..468 CDD:214485
Nucleotidyl_cyc_III 307..466 CDD:299850
CYCc 833..1060 CDD:214485 68/247 (28%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 67/241 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.