DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Gucy2g

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_620611.2 Gene:Gucy2g / 245708 RGDID:621853 Length:1103 Species:Rattus norvegicus


Alignment Length:242 Identity:94/242 - (38%)
Similarity:151/242 - (62%) Gaps:19/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 LEMLTDKLQQTFRD----LESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVG 539
            |||....|::...:    |.:||:|.::||.::||..|..:|...:.|.|:.::|||:.||.|||
  Rat   848 LEMYASHLEEVVEERTCQLVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVG 912

  Fly   540 FGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLP-DHCEDHA 603
            |.:.|:.::    .:::||:||:||::||....:.   :||||||:||.||..|||| .:...||
  Rat   913 FTKLCSLSS----PLQVVKLLNDLYSLFDHTIQTH---DVYKVETIGDAYMVASGLPIRNGAQHA 970

  Fly   604 KCMARVALDMMDMAKNVKMGSNP---VQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTET 665
            ..:|.::|.::.:..|.::|..|   :::.||:|:|.||.||:|..:|||||||:|||:.||.|:
  Rat   971 DEIATMSLHLLSVTTNFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMES 1035

  Fly   666 TGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCW 712
            :.:|.||:||:.|.|.|.:|    ..:||:.||.:.:|||......|
  Rat  1036 SSLPLRIHVSQSTARALLVA----GGYHLQKRGTISVKGKGEQTTFW 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 13/40 (33%)
CYCc 496..688 CDD:214485 81/195 (42%)
Guanylate_cyc 522..714 CDD:278633 80/195 (41%)
Gucy2gNP_620611.2 PBP1_GC_G_like 50..439 CDD:107367
ANF_receptor 66..417 CDD:279440
PK_GC 558..832 CDD:270894
CYCc 868..1058 CDD:214485 81/200 (41%)
Guanylate_cyc 895..1081 CDD:278633 80/195 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.