DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and gcy-3

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_496037.1 Gene:gcy-3 / 191641 WormBaseID:WBGene00001530 Length:1140 Species:Caenorhabditis elegans


Alignment Length:314 Identity:105/314 - (33%)
Similarity:162/314 - (51%) Gaps:49/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 RDLV------LLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRH 518
            |||:      |:...|....:.|..||:   ::::..::|..||:|.|.||..:|||.||..|:.
 Worm   823 RDLMPKTKSNLMDHVFNMLEEYTSTLEV---EVEERTKELTLEKKKADLLLSRMLPKQVAERLKA 884

  Fly   519 QRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVE 583
            .:.|.|:.:||||:.||.:|.| ...|:...|   .::|.:||:||:.||.:.:..   .|||||
 Worm   885 GQTVEPEGFDSVTVFFSDVVKF-TILASKCTP---FQVVNLLNDLYSNFDTIIEEH---GVYKVE 942

  Fly   584 TVGDKYMAVSGLPD-HCEDHAKCMARVALDMMDMAKNVKMGSNP---VQITIGIHSGEVVTGVIG 644
            ::||.|:.|||||. :..:|.|.:..::|..||..||.|:...|   |::.||::||..|.||:|
 Worm   943 SIGDGYLCVSGLPTRNGFNHIKQIVDMSLKFMDYCKNFKIPHLPRERVELRIGVNSGPCVAGVVG 1007

  Fly   645 NRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPM 709
            ..:|||||||:|||..||.|:.|.|..|:::.:.:.||..  :....:....||.||:|||....
 Worm  1008 LSMPRYCLFGDTVNTASRMESNGKPSLIHLTSDAHLLLMK--HFPHQYETNSRGEVIIKGKGVME 1070

  Fly   710 DCWFLTRATSSILGGTSSTGGSGGGGNGSLDSPLLQPATPTAGAATPIPVVAQR 763
            ..|.|                   |.:|.::..:...:||        ||..:|
 Worm  1071 TFWVL-------------------GRSGDIEPSISNRSTP--------PVTQER 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 20/61 (33%)
CYCc 496..688 CDD:214485 80/195 (41%)
Guanylate_cyc 522..714 CDD:278633 76/195 (39%)
gcy-3NP_496037.1 PBP1_NPR_GC_like 36..453 CDD:107347
ANF_receptor 54..433 CDD:279440
PKc_like 554..823 CDD:304357 105/314 (33%)
HNOBA <839..882 CDD:285003 15/45 (33%)
CYCc 861..1051 CDD:214485 80/198 (40%)
Guanylate_cyc 888..1076 CDD:278633 77/215 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.