DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and gcy-1

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:253 Identity:91/253 - (35%)
Similarity:142/253 - (56%) Gaps:16/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 LLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYD 528
            |:...|....:.|..||   :::::..::|..||:|.|.||..:|||.||..|:..:.|.|:.:|
 Worm   834 LMDHVFNMLEEYTSTLE---EEIEERTKELTLEKKKADILLSRMLPKQVAERLKAGQTVEPEGFD 895

  Fly   529 SVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVS 593
            |||:.||.:|.| ...|:...|   .:.|.:||:||:.||.:.:..   .|||||::||.|:.||
 Worm   896 SVTVFFSDVVKF-TILASKCSP---FQTVNLLNDLYSNFDTIIEQH---GVYKVESIGDGYLCVS 953

  Fly   594 GLPD-HCEDHAKCMARVALDMMDMAKNVKMGSNP---VQITIGIHSGEVVTGVIGNRVPRYCLFG 654
            |||. :...|.|.:..::|..|:..|:..:...|   |::.||::||..|.||:|..:|||||||
 Worm   954 GLPTRNGYAHIKQIVDMSLKFMEYCKSFNIPHLPRENVELRIGVNSGPCVAGVVGLSMPRYCLFG 1018

  Fly   655 NTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCW 712
            :|||..||.|:.|.|..|:::.:.:.||  ..:..:.:....||.||:|||......|
 Worm  1019 DTVNTASRMESNGKPSLIHLTNDAHSLL--TTHYPNQYETSSRGEVIIKGKGVMETFW 1074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 17/51 (33%)
CYCc 496..688 CDD:214485 77/195 (39%)
Guanylate_cyc 522..714 CDD:278633 73/195 (37%)
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357
HNOBA <840..883 CDD:285003 15/45 (33%)
CYCc 862..1051 CDD:214485 77/197 (39%)
Guanylate_cyc 889..1077 CDD:278633 73/195 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.