DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gycbeta100B and Npr3

DIOPT Version :9

Sequence 1:	NP_524603.2	Gene:	Gycbeta100B / 43682	FlyBaseID:	FBgn0013973	Length:	787	Species:	Drosophila melanogaster
Sequence 2:	NP_032754.2	Gene:	Npr3 / 18162	MGIID:	97373	Length:	536	Species:	Mus musculus

Alignment Length:	134	Identity:	30/134 - (22%)
Similarity:	55/134 - (41%)	Gaps:	40/134 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 YGFVNYALELLVLKHFGEEIW------EKIKKKAMVSMEGQFLVRQIYDDEITYNL-IGAAVEIL 59
            |.|.|  :||.....:|:..|      :...|:|..|::...|:|.:..:...::: :.::||..
Mouse   279 YAFFN--IELFNSSSYGDGSWRRGDKHDSEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQ 341

  Fly    60 NIPADDILELFGKTFFEFCQDSGYDKI-LQVLGATPRDFLQNLDALHDHLGTLYPGMRAPSFRCT 123
            .:..:|.:.:|.:.|        :|.| |.||            |||:.|...|          :
Mouse   342 GLNEEDYVNMFVEGF--------HDAILLYVL------------ALHEVLRAGY----------S 376

  Fly   124 EKDG 127
            :|||
Mouse   377 KKDG 380

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gycbeta100B	NP_524603.2	HNOB	2..164	CDD:285002	30/134 (22%)
		HNOBA	326..516	CDD:285003
		CYCc	496..688	CDD:214485
		Guanylate_cyc	522..714	CDD:278633
Npr3	NP_032754.2	PBP1_NPR_C_like	49..440	CDD:107381	30/134 (22%)
		ANF_receptor	66..419	CDD:279440	30/134 (22%)
		TM_EphA1	471..502	CDD:214014
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900