DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and acy-4

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:266 Identity:74/266 - (27%)
Similarity:130/266 - (48%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 AEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRY----DSVT 531
            :.|.....|:.|.::||     ::.:.::...:|.::||..||...........|.|    |:..
 Worm   757 SRYDFIWKLQALDEQLQ-----MKRKHEQNRSVLENILPSHVAKHFVEDATSVSKLYHESRDNAC 816

  Fly   532 LMFSGIVGFGQY---CAANTDPDGAMKIVKMLNELYTVFDALTDS----KRNLNVYKVETVGDKY 589
            :||:.:..|.::   |..|.:   .::.:::|||:.:.||.:.|.    :....:.|::|:...|
 Worm   817 IMFATLTEFDKFYIECDGNNE---GVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTY 878

  Fly   590 MAVSGLPD-HCED--HAKCMARVALDMMDMAKNVKMGS-NPVQITIGIHSGEVVTGVIGNRVPRY 650
            |..|||.. .|.|  |.:.:|..|.:::...::..:.| |...:.|||:.|.||.||||:..|.|
 Worm   879 MVASGLAGRECGDNSHVEAIALFARELLVKLESTNIHSFNNFNLRIGINVGPVVAGVIGSDKPHY 943

  Fly   651 CLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGK---------- 705
            .::||:||:.||.::.||.|||.|:||...:|     :...::.|.||.:.:|||          
 Worm   944 DIWGNSVNVASRMDSGGVAGRIQVTEEVKSIL-----EPLGYNFECRGQINVKGKGMMETFFLLP 1003

  Fly   706 PTPMDC 711
            |...||
 Worm  1004 PEDFDC 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 10/44 (23%)
CYCc 496..688 CDD:214485 60/206 (29%)
Guanylate_cyc 522..714 CDD:278633 64/215 (30%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831
CYCc 260..451 CDD:214485
Guanylate_cyc 293..448 CDD:278633
CYCc 778..984 CDD:214485 60/213 (28%)
Guanylate_cyc 807..1003 CDD:278633 60/203 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.