DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and gcy-12

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_494995.2 Gene:gcy-12 / 173902 WormBaseID:WBGene00001538 Length:1679 Species:Caenorhabditis elegans


Alignment Length:400 Identity:126/400 - (31%)
Similarity:196/400 - (49%) Gaps:76/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 FHLMFDRQ--MKI-VQAGKAVSRVIPRVAEENC-SLIEVVEAIR-----PHLQ-----LNFENIL 389
            ||.:|.|:  .|| ||.|.......|:.....| :|:|  :.:|     |:.:     |..:|  
 Worm   864 FHEIFTREGPYKIYVQRGDVNGEAAPKKDSVECRALVE--KTVRRVYSDPYFRPDTSDLEVQN-- 924

  Fly   390 SHINTIYVLQTRQGAMSSRHEQR--FLRLKGQMMYIPETDRILFQCYPSVMNLDDLTKKGLYISD 452
                  ||.:...........||  |..:|.::       :.||.              .:|..:
 Worm   925 ------YVKEVMAACWHHDPYQRPEFKTIKNKL-------KPLFH--------------QIYKQN 962

  Fly   453 VPLHDAARDLVLLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELR 517
            :..|     :||:.||::.:      ||.|.|  ::|. :|:.|::::..||..:||.|||.:|.
 Worm   963 IMDH-----MVLMMEKYQTQ------LEDLVD--ERTI-ELKDEQRRSQHLLQRMLPSSVAEQLL 1013

  Fly   518 HQRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKV 582
            ..:.|.|:.:..||:.||.||||......:|    .|::|..||:|||:||::.   |..:||||
 Worm  1014 AGQDVIPEAFPPVTIYFSDIVGFTTISGEST----PMEVVTFLNKLYTLFDSII---RRYDVYKV 1071

  Fly   583 ETVGDKYMAVSGLPDH--CEDHAKCMARVALDMMDMAKNVKM---GSNPVQITIGIHSGEVVTGV 642
            ||:||.||.|||:|.:  .|.||:.:|.:|:.::...::..:   ...|:.|.||:|:|..|.||
 Worm  1072 ETIGDAYMVVSGVPQYKTMEYHAEQIAMMAIHILSAVRSFSIPHRSCEPLMIRIGMHTGPCVAGV 1136

  Fly   643 IGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPT 707
            :|..:|||.|||:|||..||.|:.|...||:.|..|.::|   .:.|..|.||.||.:.:|||..
 Worm  1137 VGKTMPRYTLFGDTVNTASRMESNGEALRIHCSSSTQKVL---TSIDQGFLLEERGSLAIKGKGQ 1198

  Fly   708 PMDCWFLTRA 717
            ....|...||
 Worm  1199 MTTYWLNGRA 1208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 45/192 (23%)
CYCc 496..688 CDD:214485 77/196 (39%)
Guanylate_cyc 522..714 CDD:278633 78/196 (40%)
gcy-12NP_494995.2 PBP1_Speract_GC_like 123..545 CDD:107365
ANF_receptor 140..519 CDD:279440
PK_GC-A_B 648..957 CDD:270944 25/123 (20%)
TyrKc 688..951 CDD:197581 23/96 (24%)
HNOBA <967..1012 CDD:285003 18/53 (34%)
CYCc 991..1183 CDD:214485 78/201 (39%)
Guanylate_cyc 1018..1206 CDD:278633 78/197 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.