DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and gc2

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:250 Identity:102/250 - (40%)
Similarity:149/250 - (59%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 LTKNLEMLTDKLQQTFR----DLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFS 535
            :.:.||..:..|::..|    :||.|||||::||..:||.|||..|:....|.|:.::||:|.||
Zfish   824 MLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALKLGTTVEPEHFESVSLYFS 888

  Fly   536 GIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLP-DHC 599
            .|||| ...:||::|   :::|.:||:|||.|||:..   |.:||||||:||.||..||:| .:.
Zfish   889 DIVGF-TTISANSEP---IEVVDLLNDLYTTFDAVIG---NHDVYKVETIGDAYMVASGVPVPNG 946

  Fly   600 EDHAKCMARVALDMMDMAKNVK---MGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTS 661
            ..||..:|.:|||::......:   |...||:|.||:|:|..|.||:|..:|||||||:||...|
Zfish   947 NRHAAEIANMALDILSAVGTFRMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTAS 1011

  Fly   662 RTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTR 716
            |.|:||:|.||:|...|.::| |.:..  .:.:|.|....:|||......|...|
Zfish  1012 RMESTGLPYRIHVHSSTVKIL-MELKL--GYRVELRARTELKGKRIEETYWLTGR 1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 18/44 (41%)
CYCc 496..688 CDD:214485 89/195 (46%)
Guanylate_cyc 522..714 CDD:278633 82/195 (42%)
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573 18/44 (41%)
CYCc 848..1040 CDD:214485 89/201 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.