DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and gucy2f

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:246 Identity:103/246 - (41%)
Similarity:155/246 - (63%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 TKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVGF 540
            :.|||   |.:::...:||.|||:|::||..:||.|||..|:....|.|:.:|.||:.||.||||
Zfish   833 SSNLE---DLIRERTEELEVEKQRTEKLLSEMLPPSVAEALKTGASVEPEYFDQVTIYFSDIVGF 894

  Fly   541 GQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLP-DHCEDHAK 604
             ...::.:||   :::|.:||:||::|||:..|.   :||||||:||.||..|||| .:...||.
Zfish   895 -TTISSLSDP---IEVVDLLNDLYSLFDAVLGSH---DVYKVETIGDAYMVASGLPKKNGNKHAA 952

  Fly   605 CMARVALDMMDMAKNVK---MGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETT 666
            .:|.::|:::....:.|   |...||:|.||||||..|.||:|..:|||||||:|||..||.|:|
Zfish   953 EIANMSLNILSSVGSFKMRHMPEVPVRIRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMEST 1017

  Fly   667 GVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTRA 717
            |:|.||:|:..|.::| .::|  |.:.::.||...:|||......|.:.:|
Zfish  1018 GLPYRIHVNISTVQIL-RSLN--DGYKIDVRGKTELKGKGIEETYWLVGKA 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 17/39 (44%)
CYCc 496..688 CDD:214485 88/195 (45%)
Guanylate_cyc 522..714 CDD:278633 84/195 (43%)
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945
HNOBA <825..870 CDD:311573 17/39 (44%)
CYCc 850..1042 CDD:214485 90/201 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.