DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gycbeta100B and Adcy9

DIOPT Version :9

Sequence 1:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster
Sequence 2:XP_011244107.1 Gene:Adcy9 / 11515 MGIID:108450 Length:1372 Species:Mus musculus


Alignment Length:251 Identity:82/251 - (32%)
Similarity:135/251 - (53%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 LSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDS 529
            |:.:||..|:|..:.::..| |.:|  .::|.:.:.|.||.:::|..||.:|:..:.. .|.:||
Mouse  1015 LNREFEVSYRLHYHGDVEAD-LHRT--KIQSMRDQADWLLRNIIPYHVAEQLKVSQTY-SKNHDS 1075

  Fly   530 VTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSG 594
            ..::|:.||.|.::...|.  :|..:..::||||...||.|.......::.|::|:|..|||.||
Mouse  1076 GGVIFASIVNFSEFYEENY--EGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASG 1138

  Fly   595 L-------PDHCEDHAKCMARVALDMM---DMAKNVKMGSNPVQITIGIHSGEVVTGVIGNRVPR 649
            |       ..|.::|.:.:...|.:||   |...|..:..| .::.:|.:.|.:..||||.....
Mouse  1139 LNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFN-FKLRVGFNHGPLTAGVIGTTKLL 1202

  Fly   650 YCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGK 705
            |.::|:|||:.||.:||||..||.||||:||:|...     .:..:|||.|.:|||
Mouse  1203 YDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKM-----GYDFDYRGTVNVKGK 1253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 15/50 (30%)
CYCc 496..688 CDD:214485 66/201 (33%)
Guanylate_cyc 522..714 CDD:278633 66/194 (34%)
Adcy9XP_011244107.1 MFS <134..260 CDD:391944
Guanylate_cyc 385..573 CDD:306677
Guanylate_cyc 1069..1260 CDD:306677 66/194 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.